| UniProt ID | SMAD9_MOUSE | |
|---|---|---|
| UniProt AC | Q9JIW5 | |
| Protein Name | Mothers against decapentaplegic homolog 9 | |
| Gene Name | Smad9 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 430 | |
| Subcellular Localization | Cytoplasm. Nucleus. Cytoplasmic in the absence of ligand. Migrates to the nucleus when complexed with SMAD4. | |
| Protein Description | Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD9 is a receptor-regulated SMAD (R-SMAD). Has been shown to be activated by activin type I receptor-like kinases (ALK-2, ALK-3, ALK-6) which stimulate heteromerization between SMAD9 and SMAD4. May play a role in osteoblast differentiation and maturation.. | |
| Protein Sequence | MHPSTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQSLCPAPPSSPGHVFPQSPCPTSYPHSPGSPSESDSPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 74 | Phosphorylation | KCVTIPRSLDGRLQV CEEEECCCCCCCEEE | 26.00 | 20139300 | |
| 82 | Phosphorylation | LDGRLQVSHRKGLPH CCCCEEEECCCCCCE | 12.47 | 25338131 | |
| 92 | Phosphorylation | KGLPHVIYCRVWRWP CCCCEEEEEEEEECC | 3.52 | 29514104 | |
| 136 | Phosphorylation | YHYRRVETPVLPPVL CCCCCCCCCCCCCEE | 18.81 | 27180971 | |
| 286 | Phosphorylation | LSNVNRNSTIENTRR HCCCCCCCCCHHHHH | 27.76 | 30635358 | |
| 287 | Phosphorylation | SNVNRNSTIENTRRH CCCCCCCCCHHHHHH | 35.54 | 23684622 | |
| 291 | Phosphorylation | RNSTIENTRRHIGKG CCCCCHHHHHHCCCC | 19.11 | 23684622 | |
| 427 | Phosphorylation | GSPHNPISSVS---- CCCCCCCCCCC---- | 26.41 | 25619855 | |
| 428 | Phosphorylation | SPHNPISSVS----- CCCCCCCCCC----- | 27.40 | 26824392 | |
| 430 | Phosphorylation | HNPISSVS------- CCCCCCCC------- | 36.13 | 26824392 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SMAD9_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SMAD9_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SMAD9_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ERCC3_MOUSE | Ercc3 | physical | 16101586 | |
| BACH1_MOUSE | Bach1 | physical | 16101586 | |
| KLF10_MOUSE | Klf10 | physical | 16101586 | |
| PRS6A_MOUSE | Psmc3 | physical | 16101586 | |
| CXB6_MOUSE | Gjb6 | physical | 16101586 | |
| MXI1_MOUSE | Mxi1 | physical | 16101586 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
