SAP25_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SAP25_HUMAN
• UniProt AC: Q8TEE9
• Protein Name: Histone deacetylase complex subunit SAP25
• Gene Name: SAP25
• Organism: Homo sapiens (Human).
• Sequence Length: 199
• Subcellular Localization: Nucleus. Cytoplasm. Shuttles between the nucleus and the cytoplasm..
• Protein Description: Involved in the transcriptional repression mediated by the mSIN3A but not the N-CoR corepressor complex..
• Protein Sequence: MTPLAPWDPKYEAKAGPRPVWGANCSSGASFSGRTLCHPSFWPLYEAASGRGLRPVAPATGHWNGQQAPPDAGFPVVCCEDVFLSDPLLPRGQRVPLYLSKAPQQMMGSLKLLPPPPIMSARVLPRPSPSRGPSTAWLSGPELIALTGLLQMSQGEPRPSSSAVGPPDHTSDPPSPCGSPSSSQGADLSLPQTPDTHCP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
109	Phosphorylation	APQQMMGSLKLLPPP CCHHHHCCCCCCCCC	12.39	24719451
130	Phosphorylation	VLPRPSPSRGPSTAW ECCCCCCCCCCCCCC	54.96	19413330
135	Phosphorylation	SPSRGPSTAWLSGPE CCCCCCCCCCCCHHH	25.61	22210691
139	Phosphorylation	GPSTAWLSGPELIAL CCCCCCCCHHHHHHH	41.42	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SAP25_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SAP25_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SAP25_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SIN3A_HUMAN	SIN3A	physical	16449650
HDAC2_HUMAN	HDAC2	physical	16449650
TF2B_HUMAN	GTF2B	physical	16449650
PML_HUMAN	PML	physical	16449650
TTL12_HUMAN	TTLL12	physical	16449650
OGT1_HUMAN	OGT	physical	16449650
CDK4_HUMAN	CDK4	physical	16449650
XPO1_HUMAN	XPO1	physical	16449650
ZCCHV_HUMAN	ZC3HAV1	physical	16449650
PCAT1_HUMAN	LPCAT1	physical	16449650
RACK1_HUMAN	GNB2L1	physical	16449650
DNJA2_HUMAN	DNAJA2	physical	16449650
RFC1_HUMAN	RFC1	physical	16449650
PRKDC_HUMAN	PRKDC	physical	16449650
IFIT1_HUMAN	IFIT1	physical	16449650
PTBP1_HUMAN	PTBP1	physical	16449650
BRMS1_HUMAN	BRMS1	physical	16449650
SEH1_HUMAN	SEH1L	physical	16449650
IMA1_HUMAN	KPNA2	physical	16449650
RBBP7_HUMAN	RBBP7	physical	16449650
SAP30_HUMAN	SAP30	physical	16449650
CDN2A_HUMAN	CDKN2A	physical	16449650
ARF_HUMAN	CDKN2A	physical	16449650
DDX3Y_HUMAN	DDX3Y	physical	16449650
ROA1_HUMAN	HNRNPA1	physical	16449650
IFIT3_HUMAN	IFIT3	physical	16449650
PP14C_HUMAN	PPP1R14C	physical	16449650
SP130_HUMAN	SAP130	physical	16449650
SIN3B_HUMAN	SIN3B	physical	16449650

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.