UniProt ID | PRKN_MOUSE | |
---|---|---|
UniProt AC | Q9WVS6 | |
Protein Name | E3 ubiquitin-protein ligase parkin {ECO:0000305} | |
Gene Name | Prkn {ECO:0000250|UniProtKB:O60260} | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 464 | |
Subcellular Localization | Nucleus. Endoplasmic reticulum. Cytoplasm, cytosol . Cell projection, dendrite. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Mitochondrion. Cell junction, synapse. Mainly localizes in the cytosol. Expressed in the endopla | |
Protein Description | Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins, such as BCL2, SYT11, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPT5, TOMM20, USP30, ZNF746 and AIMP2. Mediates monoubiquitination as well as 'Lys-6', 'Lys-11', 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context. Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7: 'Lys-63'-linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation. Mediates 'Lys-63'-linked polyubiquitination of a 22 kDa O-linked glycosylated isoform of SNCAIP, possibly playing a role in Lewy-body formation. Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy. Promotes the autophagic degradation of dysfunctional depolarized mitochondria (mitophagy) by promoting the ubiquitination of mitochondrial proteins such as TOMM20, RHOT1/MIRO1 and USP30. Preferentially assembles 'Lys-6'-, 'Lys-11'- and 'Lys-63'-linked polyubiquitin chains following mitochondrial damage, leading to mitophagy. Mediates 'Lys-48'-linked polyubiquitination of ZNF746, followed by degradation of ZNF746 by the proteasome; possibly playing a role in the regulation of neuron death. Limits the production of reactive oxygen species (ROS). Regulates cyclin-E during neuronal apoptosis. In collaboration with CHPF isoform 2, may enhance cell viability and protect cells from oxidative stress. Independently of its ubiquitin ligase activity, protects from apoptosis by the transcriptional repression of p53/TP53. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. May represent a tumor suppressor gene.. | |
Protein Sequence | MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
65 | Phosphorylation | NCDLEQQSIVHIVQR CCCCHHHHHEEEECC | - | ||
77 | Phosphorylation | VQRPRRRSHETNASG ECCCCCCCCCCCCCC | 19060867 | ||
80 | Phosphorylation | PRRRSHETNASGGDE CCCCCCCCCCCCCCC | 11122330 | ||
83 | Phosphorylation | RSHETNASGGDEPQS CCCCCCCCCCCCCCC | 29899451 | ||
90 | Phosphorylation | SGGDEPQSTSEGSIW CCCCCCCCCCCCCCC | 21183079 | ||
108 | Phosphorylation | SLTRVDLSSHTLPVD CCEEEECCCCCCCCC | 21183079 | ||
109 | Phosphorylation | LTRVDLSSHTLPVDS CEEEECCCCCCCCCC | 19060867 | ||
111 | Phosphorylation | RVDLSSHTLPVDSVG EEECCCCCCCCCCEE | 23984901 | ||
174 | Phosphorylation | TCKQATLTLAQGPSC CCCCEEEEECCCCCC | - | ||
216 | Phosphorylation | FKCGAHPTSDKDTSV EECCCCCCCCCCCHH | - | ||
312 | Phosphorylation | ILGEEQYTRYQQYGA ECCHHHHHHHHHHCC | 21454597 |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
65 | S | Phosphorylation |
| - |
65 | S | ubiquitylation |
| - |
174 | T | Phosphorylation |
| - |
216 | T | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRKN_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BCL2_MOUSE | Bcl2 | physical | 20889974 | |
ABL1_MOUSE | Abl1 | physical | 20823226 | |
AMRA1_MOUSE | Ambra1 | physical | 21753002 | |
CSKP_MOUSE | Cask | physical | 17553932 | |
SH3G2_MOUSE | Sh3gl2 | physical | 20064468 | |
SH3G1_MOUSE | Sh3gl1 | physical | 20064468 | |
SH3G3_MOUSE | Sh3gl3 | physical | 20064468 | |
SYUA_HUMAN | SNCA | genetic | 19680561 | |
ACTS_MOUSE | Acta1 | physical | 19909785 | |
BAX_MOUSE | Bax | physical | 22460798 | |
HDAC6_MOUSE | Hdac6 | physical | 23258539 | |
TADBP_HUMAN | TARDBP | physical | 23258539 | |
BECN1_MOUSE | Becn1 | physical | 24879156 | |
ACTB_MOUSE | Actb | physical | 24879156 | |
BECN1_MOUSE | Becn1 | physical | 23737459 | |
UCHL1_MOUSE | Uchl1 | physical | 25403879 | |
MFN2_MOUSE | Mfn2 | physical | 24379352 | |
HS71A_MOUSE | Hspa1a | physical | 24379352 | |
UB2L3_MOUSE | Ube2l3 | physical | 20064468 | |
PTN5_MOUSE | Ptpn5 | physical | 25583483 | |
BECN1_MOUSE | Becn1 | physical | 24386307 | |
GRIK2_MOUSE | Grik2 | physical | 25316086 | |
CAV1_MOUSE | Cav1 | physical | 26627850 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...