dbPTM

SH3G3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SH3G3_MOUSE
UniProt AC	Q62421
Protein Name	Endophilin-A3
Gene Name	Sh3gl3
Organism	Mus musculus (Mouse).
Sequence Length	347
Subcellular Localization	Cytoplasm . Early endosome membrane Peripheral membrane protein . Associated with postsynaptic endosomes in hippocampal neurons. Associated with presynaptic endosomes in olfactory neurons.
Protein Description	Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity)..
Protein Sequence	MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFVEAALDYHRQSTEILQELQSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSSKTPGTDTPADQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPLPP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSVAGLKKQ ------CCHHHHHHH	22.22	22006019
82	Ubiquitination	SKLRGQVKATGYPQT HHHCCCHHHCCCCCC	32.13	22790023
283	Phosphorylation	SKTPGTDTPADQPCC CCCCCCCCCCCCCCC	21.88	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SH3G3_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SH3G3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SH3G3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRKN_MOUSE	Park2	physical	20064468
AMPH_MOUSE	Amph	physical	12456676
BIN1_MOUSE	Bin1	physical	12456676
DYN1_MOUSE	Dnm1	physical	12456676
SYN1_MOUSE	Syn1	physical	12456676

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SH3G3_MOUSE

Related Literatures of Post-Translational Modification