BCL2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BCL2_MOUSE
• UniProt AC: P10417
• Protein Name: Apoptosis regulator Bcl-2
• Gene Name: Bcl2
• Organism: Mus musculus (Mouse).
• Sequence Length: 236
• Subcellular Localization: Mitochondrion outer membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.
• Protein Description: Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release. [PubMed: 17418785]
• Protein Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
69	Phosphorylation	HRDMAARTSPLRPLV CHHHHCCCCCCCHHH	29.94	25266776
70	Phosphorylation	RDMAARTSPLRPLVA HHHHCCCCCCCHHHC	19.18	10677502
78	Phosphorylation	PLRPLVATAGPALSP CCCHHHCCCCCCCCC	25.35	21183079
84	Phosphorylation	ATAGPALSPVPPVVH CCCCCCCCCCCCEEE	26.42	14660795

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
69	T	Phosphorylation	Kinase	MAPK8	Q91Y86	Uniprot
70	S	Phosphorylation	Kinase	CDK5	P49615	PSP
70	S	Phosphorylation	Kinase	MAPK1	P28482	GPS
70	S	Phosphorylation	Kinase	ERK2	P63085	PSP
70	S	Phosphorylation	Kinase	ERK1	P27361	PSP
70	S	Phosphorylation	Kinase	MAPK3	Q63844	GPS
70	S	Phosphorylation	Kinase	MAPK8	P45983	GPS
70	S	Phosphorylation	Kinase	MAPK8	Q91Y86	Uniprot
70	S	Phosphorylation	Kinase	MAPK8	Q91Y86	GPS
70	S	Phosphorylation	Kinase	PKC-FAMILY	-	GPS
70	S	Phosphorylation	Kinase	PKC	-	Uniprot
84	S	Phosphorylation	Kinase	MAPK8	Q91Y86	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
69	T	Phosphorylation	Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, wich stimulates starvation-induced autophagy (By similarity).	9115213
70	S	Phosphorylation	Growth factor-stimulated phosphorylation on Ser-70 by PKC is required for the anti-apoptosis activity and occurs during the G2/M phase of the cell cycle.	9115213
70	S	Phosphorylation	Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, wich stimulates starvation-induced autophagy (By similarity).	9115213
70	S	Phosphorylation	Phosphorylation/dephosphorylation on Ser-70 regulates anti-apoptotic activity.	9115213
84	S	Phosphorylation	Phosphorylated by MAPK8/JNK1 at Thr-69, Ser-70 and Ser-84, wich stimulates starvation-induced autophagy (By similarity).	9115213

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BCL2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FAK1_MOUSE	Ptk2	physical	10417825
PAXI_HUMAN	PXN	physical	10417825
BAG3_MOUSE	Bag3	physical	11527400
BAG4_MOUSE	Bag4	physical	11527400
PP2BA_MOUSE	Ppp3ca	physical	12617961
MYC_MOUSE	Myc	physical	17382917
CANB1_MOUSE	Ppp3r1	physical	16717086
PP2AA_MOUSE	Ppp2ca	physical	16717086
VA0D2_MOUSE	Atp6v0d2	physical	16717086
ACTZ_MOUSE	Actr1a	physical	16717086
SNAA_MOUSE	Napa	physical	16717086
SNAG_MOUSE	Napg	physical	16717086
SNG1_MOUSE	Syngr1	physical	16717086
BAX_MOUSE	Bax	physical	8631771
PAXI_MOUSE	Pxn	physical	14699151
B2L11_MOUSE	Bcl2l11	physical	23840878
CPT1A_MOUSE	Cpt1a	physical	9070836
BECN1_MOUSE	Becn1	physical	18281291
BNIP3_MOUSE	Bnip3	physical	18281291
TCAM1_MOUSE	Ticam1	physical	18772134
BECN1_MOUSE	Becn1	physical	18772134
MYD88_MOUSE	Myd88	physical	18772134

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.