UniProt ID | CANB1_MOUSE | |
---|---|---|
UniProt AC | Q63810 | |
Protein Name | Calcineurin subunit B type 1 | |
Gene Name | Ppp3r1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 170 | |
Subcellular Localization |
Cytoplasm, cytosol . Cell membrane . Cell membrane, sarcolemma . Cell membrane Lipid-anchor . Translocates from the cytosol to the sarcolemma in a CIB1-dependent manner during cardiomyocyte hypertrophy. |
|
Protein Description | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.. | |
Protein Sequence | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNEASYPL ------CCCCCCCCH | 40.46 | - | |
85 | Ubiquitination | GVSQFSVKGDKEQKL CCCEEEECCCHHHHE | 61.26 | 22790023 | |
99 | Phosphorylation | LRFAFRIYDMDKDGY EEEEEEEEECCCCCC | 10.85 | 20415495 | |
106 | Phosphorylation | YDMDKDGYISNGELF EECCCCCCCCHHHHH | 16.00 | 16141072 | |
108 | Phosphorylation | MDKDGYISNGELFQV CCCCCCCCHHHHHHH | 30.23 | 29899451 | |
125 | Ubiquitination | MMVGNNLKDTQLQQI HHHCCCCCHHHHHHH | 61.93 | 22790023 | |
135 | Ubiquitination | QLQQIVDKTIINADK HHHHHHCCEEECCCC | 30.63 | 22790023 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CANB1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CANB1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CANB1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of CANB1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale identification and evolution indexing of tyrosinephosphorylation sites from murine brain."; Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.; J. Proteome Res. 7:311-318(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-106, AND MASSSPECTROMETRY. |