| UniProt ID | SNAG_MOUSE | |
|---|---|---|
| UniProt AC | Q9CWZ7 | |
| Protein Name | Gamma-soluble NSF attachment protein | |
| Gene Name | Napg | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 312 | |
| Subcellular Localization |
Membrane Peripheral membrane protein. |
|
| Protein Description | Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.. | |
| Protein Sequence | MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSEVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGAAGMAAEEEEDEYSGGLC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Acetylation | ---MAAQKINEGLEH ---CCHHHHHHHHHH | 42.65 | 22902405 | |
| 15 | Acetylation | EGLEHLAKAEKYLKT HHHHHHHHHHHHHHH | 64.54 | 22902405 | |
| 18 | Acetylation | EHLAKAEKYLKTGFL HHHHHHHHHHHHCCC | 61.82 | 22902405 | |
| 46 | Acetylation | GKAAVAFKNAKQFEQ HHHHHHHHCHHHHHH | 46.38 | 22902405 | |
| 49 | Malonylation | AVAFKNAKQFEQAKD HHHHHCHHHHHHHHH | 65.98 | 26320211 | |
| 55 | Ubiquitination | AKQFEQAKDACLREA HHHHHHHHHHHHHHH | 45.62 | - | |
| 86 | Ubiquitination | EQAGMMLKEMQKLPE HHHCHHHHHHHHHHH | 32.99 | - | |
| 244 | Ubiquitination | QLLEGYDQQDQDQVS HHHCCCCCCCHHHHH | 40.02 | 27667366 | |
| 249 | Ubiquitination | YDQQDQDQVSEVCNS CCCCCHHHHHHHHCC | 34.70 | 27667366 | |
| 268 | Ubiquitination | YMDNDYAKLGLSLVV HCCCCHHHHCCEEEE | 36.54 | - | |
| 272 | Phosphorylation | DYAKLGLSLVVPGGG CHHHHCCEEEECCCC | 19.81 | - | |
| 281 | Ubiquitination | VVPGGGIKKKSPATP EECCCCCCCCCCCCC | 58.38 | 27667366 | |
| 284 | Phosphorylation | GGGIKKKSPATPQAK CCCCCCCCCCCCCCC | 28.75 | 25521595 | |
| 287 | Phosphorylation | IKKKSPATPQAKPDG CCCCCCCCCCCCCCC | 21.22 | 25521595 | |
| 307 | Phosphorylation | AEEEEDEYSGGLC-- CHHCCCCCCCCCC-- | 25.57 | 25619855 | |
| 308 | Phosphorylation | EEEEDEYSGGLC--- HHCCCCCCCCCC--- | 25.08 | 25619855 | |
| 312 | S-palmitoylation | DEYSGGLC------- CCCCCCCC------- | 6.24 | 28680068 | |
| 331 | Ubiquitination | -------------------------- -------------------------- | 27667366 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNAG_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNAG_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNAG_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SNAG_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-284, AND MASSSPECTROMETRY. | |
