UniProt ID | SNAG_MOUSE | |
---|---|---|
UniProt AC | Q9CWZ7 | |
Protein Name | Gamma-soluble NSF attachment protein | |
Gene Name | Napg | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 312 | |
Subcellular Localization |
Membrane Peripheral membrane protein. |
|
Protein Description | Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.. | |
Protein Sequence | MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSEVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGAAGMAAEEEEDEYSGGLC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MAAQKINEGLEH ---CCHHHHHHHHHH | 42.65 | 22902405 | |
15 | Acetylation | EGLEHLAKAEKYLKT HHHHHHHHHHHHHHH | 64.54 | 22902405 | |
18 | Acetylation | EHLAKAEKYLKTGFL HHHHHHHHHHHHCCC | 61.82 | 22902405 | |
46 | Acetylation | GKAAVAFKNAKQFEQ HHHHHHHHCHHHHHH | 46.38 | 22902405 | |
49 | Malonylation | AVAFKNAKQFEQAKD HHHHHCHHHHHHHHH | 65.98 | 26320211 | |
55 | Ubiquitination | AKQFEQAKDACLREA HHHHHHHHHHHHHHH | 45.62 | - | |
86 | Ubiquitination | EQAGMMLKEMQKLPE HHHCHHHHHHHHHHH | 32.99 | - | |
244 | Ubiquitination | QLLEGYDQQDQDQVS HHHCCCCCCCHHHHH | 40.02 | 27667366 | |
249 | Ubiquitination | YDQQDQDQVSEVCNS CCCCCHHHHHHHHCC | 34.70 | 27667366 | |
268 | Ubiquitination | YMDNDYAKLGLSLVV HCCCCHHHHCCEEEE | 36.54 | - | |
272 | Phosphorylation | DYAKLGLSLVVPGGG CHHHHCCEEEECCCC | 19.81 | - | |
281 | Ubiquitination | VVPGGGIKKKSPATP EECCCCCCCCCCCCC | 58.38 | 27667366 | |
284 | Phosphorylation | GGGIKKKSPATPQAK CCCCCCCCCCCCCCC | 28.75 | 25521595 | |
287 | Phosphorylation | IKKKSPATPQAKPDG CCCCCCCCCCCCCCC | 21.22 | 25521595 | |
307 | Phosphorylation | AEEEEDEYSGGLC-- CHHCCCCCCCCCC-- | 25.57 | 25619855 | |
308 | Phosphorylation | EEEEDEYSGGLC--- HHCCCCCCCCCC--- | 25.08 | 25619855 | |
312 | S-palmitoylation | DEYSGGLC------- CCCCCCCC------- | 6.24 | 28680068 | |
331 | Ubiquitination | -------------------------- -------------------------- | 27667366 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SNAG_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SNAG_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SNAG_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SNAG_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Qualitative and quantitative analyses of protein phosphorylation innaive and stimulated mouse synaptosomal preparations."; Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,Gerrits B., Panse C., Schlapbach R., Mansuy I.M.; Mol. Cell. Proteomics 6:283-293(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-284, AND MASSSPECTROMETRY. |