| UniProt ID | ACTZ_MOUSE | |
|---|---|---|
| UniProt AC | P61164 | |
| Protein Name | Alpha-centractin | |
| Gene Name | Actr1a | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 376 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cell cortex . | |
| Protein Description | Component of a multi-subunit complex involved in microtubule based vesicle motility. It is associated with the centrosome.. | |
| Protein Sequence | MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGPKAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKNRERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQYYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGARSIHRKTF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MESYDVIA -------CCCCCEEC | 7.52 | - | |
| 3 | Phosphorylation | -----MESYDVIANQ -----CCCCCEECCC | 25.90 | 46158781 | |
| 32 | Ubiquitination | FAGDQIPKYCFPNYV CCCCCCCCCCCCCCC | 57.17 | 22790023 | |
| 34 | S-nitrosocysteine | GDQIPKYCFPNYVGR CCCCCCCCCCCCCCC | 5.96 | - | |
| 34 | S-nitrosylation | GDQIPKYCFPNYVGR CCCCCCCCCCCCCCC | 5.96 | 20925432 | |
| 73 | Phosphorylation | RGLLSIRYPMEHGIV CCCEEEECCCCCCCC | 12.78 | 41301487 | |
| 96 | Ubiquitination | IWQYVYSKDQLQTFS HHHHHCCHHHHHCCC | 31.63 | 22790023 | |
| 171 | Phosphorylation | VTHAVPIYEGFAMPH CEEEEEEECCCCCCC | 12.15 | 82493 | |
| 296 | Phosphorylation | DLRRTLFSNIVLSGG HHHHHHHHCEEECCC | 28.85 | - | |
| 308 | Ubiquitination | SGGSTLFKGFGDRLL CCCCHHHCCHHHHHH | 57.34 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ACTZ_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ACTZ_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ACTZ_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DCTN6_HUMAN | DCTN6 | physical | 20360068 | |
| DCTN2_HUMAN | DCTN2 | physical | 20360068 | |
| ARP10_HUMAN | ACTR10 | physical | 20360068 | |
| DCTN1_HUMAN | DCTN1 | physical | 20360068 | |
| DCTN4_HUMAN | DCTN4 | physical | 20360068 | |
| ACTY_HUMAN | ACTR1B | physical | 20360068 | |
| ACTZ_HUMAN | ACTR1A | physical | 20360068 | |
| DCTN3_HUMAN | DCTN3 | physical | 20360068 | |
| DCTN5_HUMAN | DCTN5 | physical | 20360068 | |
| ACTB_HUMAN | ACTB | physical | 12857853 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
