BAX_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BAX_MOUSE
• UniProt AC: Q07813
• Protein Name: Apoptosis regulator BAX
• Gene Name: Bax
• Organism: Mus musculus (Mouse).
• Sequence Length: 192
• Subcellular Localization: Isoform Alpha: Mitochondrion outer membrane; Single-pass membrane protein. Cytoplasm. Colocalizes with 14-3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 prote
• Protein Description: Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. BAX deficiency leads to lymphoid hyperplasia and male sterility, because of the cessation of sperm production..
• Protein Sequence: MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGETPELTLEQPPQDASTKKLSECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWEGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDGSGEQL -------CCCCCCCC	13.70	-
4	Phosphorylation	----MDGSGEQLGSG ----CCCCCCCCCCC	34.59	26643407
10	Phosphorylation	GSGEQLGSGGPTSSE CCCCCCCCCCCCCHH	49.52	26643407
14	Phosphorylation	QLGSGGPTSSEQIMK CCCCCCCCCHHHHHH	48.43	26643407
15	Phosphorylation	LGSGGPTSSEQIMKT CCCCCCCCHHHHHHH	34.70	26643407
16	Phosphorylation	GSGGPTSSEQIMKTG CCCCCCCHHHHHHHH	35.68	26643407
42	Phosphorylation	AGRMAGETPELTLEQ HHHCCCCCCCCCCCC	22.58	25338131
57	Ubiquitination	PPQDASTKKLSECLR CCCCCCHHHHHHHHH	49.58	22790023
62	Glutathionylation	STKKLSECLRRIGDE CHHHHHHHHHHHHHH	3.00	24333276
87	Phosphorylation	IADVDTDSPREVFFR HHCCCCCCHHHHHHH	28.13	22817900
184	Phosphorylation	VAGVLTASLTIWKKM HHHHHHHHHHHHHHC	22.32	14766748

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
184	S	Phosphorylation	Kinase	AKT-FAMILY	-	GPS
184	S	Phosphorylation	Kinase	PKB_GROUP	-	PhosphoELM

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BAX_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BAX_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BXI1_YEAST	BXI1	genetic	21673659
HSP74_HUMAN	HSPA4	physical	14752510
HSP7C_HUMAN	HSPA8	physical	14752510
PARK7_HUMAN	PARK7	physical	14752510
DNJA1_HUMAN	DNAJA1	physical	14752510
PRKN_MOUSE	Park2	physical	22460798
B2CL2_MOUSE	Bcl2l2	genetic	11784036
B2CL1_MOUSE	Bcl2l1	physical	8798452
BCL2_MOUSE	Bcl2	physical	8631771
BAX_MOUSE	Bax	physical	8631771
CALX_MOUSE	Canx	physical	12847083
COX41_MOUSE	Cox4i1	physical	12847083
BCL2_MOUSE	Bcl2	physical	9115213
MCL1_HUMAN	MCL1	physical	9742125
BCL2_HUMAN	BCL2	physical	9742125
B2CL1_HUMAN	BCL2L1	physical	9742125
BAX_MOUSE	Bax	physical	9742125
NT5C_MOUSE	Nt5c	physical	22277657
TEBP_MOUSE	Ptges3	physical	22277657

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.