B2CL2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: B2CL2_MOUSE
• UniProt AC: P70345
• Protein Name: Bcl-2-like protein 2
• Gene Name: Bcl2l2
• Organism: Mus musculus (Mouse).
• Sequence Length: 193
• Subcellular Localization: Mitochondrion membrane; Peripheral membrane protein. Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane (By similarity)..
• Protein Description: Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX..
• Protein Sequence: MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MATPASTPD ------CCCCCCCCC	23.45	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of B2CL2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of B2CL2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of B2CL2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PAXI_MOUSE	Pxn	physical	14699151

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.