BXI1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BXI1_YEAST
• UniProt AC: P48558
• Protein Name: Bax inhibitor 1
• Gene Name: BXI1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 297
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Vacuole membrane ; Multi-pass membrane protein . Mitochondrion membrane ; Multi-pass membrane protein . Translocated from predominantly vacuolar sites in healthy cells to mitochondria upo
• Protein Description: Links the unfolded protein response and programmed cell death and mediates mitochondrial-dependent apoptosis. [PubMed: 21673659]
• Protein Sequence: MSGPPPPYEEQSSHLYGQPASSQDGNAFIPEDFKYSTVVISCEPIIRQRFMHKVYSLLSCQLLASLSFCYWASVSTSLQNFIMSHIALFYICMVVSLVSCIWLAVSPRPEDYEASVPEPLLTGSSEEPAQEQRRLPWYVLSSYKQKLTLLSIFTLSEAYCLSLVTLAYDKDTVLSALLITTIVVVGVSLTALSERFENVLNSATSIYYWLNWGLWIMIGMGLTALLFGWNTHSSKFNLLYGWLGAILFTAYLFIDTQLIFRKVYPDEEVRCAMMLYLDIVNLFLSILRILANSNDDN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of BXI1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RSP5	P39940	PMID:22199232

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BXI1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BXI1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SUR1_YEAST	SUR1	genetic	21673659
SUR1_YEAST	SUR1	physical	21673659
UTH1_YEAST	UTH1	genetic	21673659
QCR1_YEAST	COR1	physical	21673659
HSP82_YEAST	HSP82	physical	21673659
RSP5_YEAST	RSP5	physical	21673659
VDAC1_YEAST	POR1	physical	21673659
ADT2_YEAST	PET9	physical	21673659
MPCP_YEAST	MIR1	physical	21673659
QCR2_YEAST	QCR2	physical	21673659
ATPB_YEAST	ATP2	physical	21673659
BIOA_YEAST	BIO3	physical	21673659
COX4_YEAST	COX4	physical	21673659
COX2_YEAST	COX2	physical	21673659
HSP73_YEAST	SSA3	physical	21673659
QCR1_YEAST	COR1	genetic	21673659
MPCP_YEAST	MIR1	genetic	21673659
CDC37_YEAST	CDC37	genetic	27708008
STU1_YEAST	STU1	genetic	27708008
KPC1_YEAST	PKC1	genetic	27708008
APC11_YEAST	APC11	genetic	27708008
GNA1_YEAST	GNA1	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
UTP13_YEAST	UTP13	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.