NT5C_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NT5C_MOUSE
• UniProt AC: Q9JM14
• Protein Name: 5'(3')-deoxyribonucleotidase, cytosolic type
• Gene Name: Nt5c
• Organism: Mus musculus (Mouse).
• Sequence Length: 200
• Subcellular Localization: Cytoplasm.
• Protein Description: Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP..
• Protein Sequence: MAVKRPVRVLVDMDGVLADFESGLLQGFRRRFPEEPHVPLEQRRGFLANEQYGALRPDLAEKVASVYESPGFFLNLEPIPGALDALREMNDMKDTEVFICTTPLLKYDHCVGEKYRWVEQNLGPEFVERIILTRDKTVVMGDLLIDDKDNIQGLEETPSWEHILFTCCHNQHLALPPTRRRLLSWSDNWRGIIESKRASL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
101	Phosphorylation	DTEVFICTTPLLKYD CCEEEEECCCCHHCC	26.99	26745281
102	Phosphorylation	TEVFICTTPLLKYDH CEEEEECCCCHHCCC	13.92	25521595
114	Acetylation	YDHCVGEKYRWVEQN CCCCCCHHHHHHHHH	33.90	22826441
184	Phosphorylation	PTRRRLLSWSDNWRG CCHHHHHHCCCCHHH	29.17	26824392
186	Phosphorylation	RRRLLSWSDNWRGII HHHHHHCCCCHHHHH	20.07	23984901

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NT5C_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NT5C_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NT5C_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of NT5C_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.