| UniProt ID | NUDC2_HUMAN | |
|---|---|---|
| UniProt AC | Q8WVJ2 | |
| Protein Name | NudC domain-containing protein 2 | |
| Gene Name | NUDCD2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 157 | |
| Subcellular Localization | Chromosome, centromere, kinetochore . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . Cytoplasm, cytoskeleton, spindle pole . Associates with centrosomes in interphase and to spindle poles and kinetochores during mitosis. | |
| Protein Description | May regulate the LIS1/dynein pathway by stabilizing LIS1 with Hsp90 chaperone.. | |
| Protein Sequence | MSAPFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSVGGREILKGKLFDSTIADEGTWTLEDRKMVRIVLTKTKRDAANCWTSLLESEYAADPWVQDQMQRKLTLERFQKENPGFDFSGAEISGNYTKGGPDFSNLEK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSAPFEERS ------CCCCCHHCC | 44.65 | 30108239 | |
| 2 | Acetylation | ------MSAPFEERS ------CCCCCHHCC | 44.65 | 22814378 | |
| 41 | Ubiquitination | VPPGTRAQDIQCGLQ CCCCCCHHHCCCCCC | 45.08 | 24816145 | |
| 55 | Phosphorylation | QSRHVALSVGGREIL CCCEEEEEECCEEHH | 14.69 | 23312004 | |
| 65 | Ubiquitination | GREILKGKLFDSTIA CEEHHCCCCCCCEEC | 44.38 | 29967540 | |
| 69 | Phosphorylation | LKGKLFDSTIADEGT HCCCCCCCEECCCCC | 17.87 | 28348404 | |
| 70 | Phosphorylation | KGKLFDSTIADEGTW CCCCCCCEECCCCCE | 23.25 | 28348404 | |
| 79 | Ubiquitination | ADEGTWTLEDRKMVR CCCCCEEECHHHEEE | 4.93 | 23000965 | |
| 91 | Acetylation | MVRIVLTKTKRDAAN EEEEEEECCHHHHHH | 48.14 | 25953088 | |
| 91 | Ubiquitination | MVRIVLTKTKRDAAN EEEEEEECCHHHHHH | 48.14 | 24816145 | |
| 97 | Ubiquitination | TKTKRDAANCWTSLL ECCHHHHHHHHHHHH | 18.92 | 32015554 | |
| 108 | Phosphorylation | TSLLESEYAADPWVQ HHHHHHHHHCCHHHH | 19.17 | 27642862 | |
| 121 | Ubiquitination | VQDQMQRKLTLERFQ HHHHHHHHHHHHHHH | 29.00 | - | |
| 123 | Phosphorylation | DQMQRKLTLERFQKE HHHHHHHHHHHHHHH | 29.61 | 29496963 | |
| 129 | Ubiquitination | LTLERFQKENPGFDF HHHHHHHHHCCCCCC | 57.66 | 23000965 | |
| 137 | Phosphorylation | ENPGFDFSGAEISGN HCCCCCCCCCCCCCC | 38.65 | 25159151 | |
| 142 | Phosphorylation | DFSGAEISGNYTKGG CCCCCCCCCCCCCCC | 16.70 | 21945579 | |
| 145 | Phosphorylation | GAEISGNYTKGGPDF CCCCCCCCCCCCCCC | 17.22 | 21945579 | |
| 146 | Phosphorylation | AEISGNYTKGGPDFS CCCCCCCCCCCCCCH | 27.49 | 21945579 | |
| 147 | Ubiquitination | EISGNYTKGGPDFSN CCCCCCCCCCCCCHH | 52.06 | 22817900 | |
| 147 | Sumoylation | EISGNYTKGGPDFSN CCCCCCCCCCCCCHH | 52.06 | - | |
| 153 | Phosphorylation | TKGGPDFSNLEK--- CCCCCCCHHCCC--- | 48.13 | 21815630 | |
| 157 | Acetylation | PDFSNLEK------- CCCHHCCC------- | 69.66 | 90755 | |
| 157 | Ubiquitination | PDFSNLEK------- CCCHHCCC------- | 69.66 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NUDC2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NUDC2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NUDC2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
