UniProt ID | SPSY_HUMAN | |
---|---|---|
UniProt AC | P52788 | |
Protein Name | Spermine synthase | |
Gene Name | SMS | |
Organism | Homo sapiens (Human). | |
Sequence Length | 366 | |
Subcellular Localization | ||
Protein Description | Catalyzes the production of spermine from spermidine and decarboxylated S-adenosylmethionine (dcSAM).. | |
Protein Sequence | MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRAIMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDVLDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTVWKKAKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAARHSTL ------CCCCCCCCH | 15.16 | 19413330 | |
7 | Phosphorylation | -MAAARHSTLDFMLG -CCCCCCCCHHHHHC | 25.72 | 20068231 | |
8 | Phosphorylation | MAAARHSTLDFMLGA CCCCCCCCHHHHHCC | 24.99 | 28857561 | |
16 | Ubiquitination | LDFMLGAKADGETIL HHHHHCCCCCHHHHH | 45.25 | 21963094 | |
16 | 2-Hydroxyisobutyrylation | LDFMLGAKADGETIL HHHHHCCCCCHHHHH | 45.25 | - | |
21 | Phosphorylation | GAKADGETILKGLQS CCCCCHHHHHHHHHH | 36.82 | 20068231 | |
49 | Ubiquitination | WQDHGYLATYTNKNG CCCCCEEEEEECCCC | 7.06 | 21963094 | |
57 | Phosphorylation | TYTNKNGSFANLRIY EEECCCCCEEEEEEE | 30.49 | 23897707 | |
64 | Ubiquitination | SFANLRIYPHGLVLL CEEEEEEECCCEEEE | 5.24 | 24816145 | |
83 | Ubiquitination | YDGDAQGKEEIDSIL CCCCCCCHHHHHHHH | 39.84 | 21963094 | |
88 | Phosphorylation | QGKEEIDSILNKVEE CCHHHHHHHHHHHHH | 34.34 | 25159151 | |
92 | Ubiquitination | EIDSILNKVEERMKE HHHHHHHHHHHHHHH | 47.80 | 29967540 | |
98 | Ubiquitination | NKVEERMKELSQDST HHHHHHHHHHHCCCC | 62.82 | 21963094 | |
98 (in isoform 2) | Ubiquitination | - | 62.82 | 21890473 | |
101 | Phosphorylation | EERMKELSQDSTGRV HHHHHHHHCCCCCCC | 32.79 | 28857561 | |
103 | Ubiquitination | RMKELSQDSTGRVKR HHHHHHCCCCCCCCC | 44.80 | 23503661 | |
104 | Phosphorylation | MKELSQDSTGRVKRL HHHHHCCCCCCCCCC | 25.73 | 20068231 | |
105 | Phosphorylation | KELSQDSTGRVKRLP HHHHCCCCCCCCCCC | 36.98 | 20068231 | |
117 | Ubiquitination | RLPPIVRGGAIDRYW CCCCEECCCCCCCCC | 20.99 | 21890473 | |
122 | Methylation | VRGGAIDRYWPTADG ECCCCCCCCCCCCCC | 29.33 | 115917321 | |
122 | Ubiquitination | VRGGAIDRYWPTADG ECCCCCCCCCCCCCC | 29.33 | 23503661 | |
133 (in isoform 2) | Ubiquitination | - | 41.92 | 21890473 | |
133 | Ubiquitination | TADGRLVEYDIDEVV CCCCCEEEEECCEEE | 41.92 | 27667366 | |
134 | Phosphorylation | ADGRLVEYDIDEVVY CCCCEEEEECCEEEE | 15.66 | - | |
139 | Ubiquitination | VEYDIDEVVYDEDSP EEEECCEEEECCCCC | 4.25 | 29967540 | |
141 | Phosphorylation | YDIDEVVYDEDSPYQ EECCEEEECCCCCCC | 20.84 | - | |
147 | Phosphorylation | VYDEDSPYQNIKILH EECCCCCCCCEEEEE | 20.38 | 25147952 | |
151 (in isoform 1) | Ubiquitination | - | 46.92 | 21890473 | |
151 | Ubiquitination | DSPYQNIKILHSKQF CCCCCCEEEEEECEE | 46.92 | 21963094 | |
152 | Ubiquitination | SPYQNIKILHSKQFG CCCCCEEEEEECEEC | 3.56 | 27667366 | |
156 | Ubiquitination | NIKILHSKQFGNILI CEEEEEECEECCEEE | 38.61 | 23503661 | |
177 (in isoform 2) | Ubiquitination | - | 12.21 | 21890473 | |
177 | Ubiquitination | LAESDLAYTRAIMGS HHHCHHHHHHHHHCC | 12.21 | 23000965 | |
178 | Ubiquitination | AESDLAYTRAIMGSG HHCHHHHHHHHHCCC | 14.17 | 23000965 | |
182 | Sulfoxidation | LAYTRAIMGSGKEDY HHHHHHHHCCCCCCC | 3.22 | 30846556 | |
182 | Ubiquitination | LAYTRAIMGSGKEDY HHHHHHHHCCCCCCC | 3.22 | 23000965 | |
184 | Phosphorylation | YTRAIMGSGKEDYTG HHHHHHCCCCCCCCC | 29.34 | - | |
186 (in isoform 1) | Ubiquitination | - | 49.46 | 21890473 | |
186 | Ubiquitination | RAIMGSGKEDYTGKD HHHHCCCCCCCCCCE | 49.46 | 21906983 | |
186 | 2-Hydroxyisobutyrylation | RAIMGSGKEDYTGKD HHHHCCCCCCCCCCE | 49.46 | - | |
189 | Phosphorylation | MGSGKEDYTGKDVLI HCCCCCCCCCCEEEE | 20.62 | - | |
190 | Phosphorylation | GSGKEDYTGKDVLIL CCCCCCCCCCEEEEE | 50.51 | - | |
192 | Ubiquitination | GKEDYTGKDVLILGG CCCCCCCCEEEEECC | 36.54 | 21963094 | |
196 | Ubiquitination | YTGKDVLILGGGDGG CCCCEEEEECCCCCC | 3.18 | 23000965 | |
197 | Ubiquitination | TGKDVLILGGGDGGI CCCEEEEECCCCCCC | 4.57 | 23000965 | |
201 | Ubiquitination | VLILGGGDGGILCEI EEEECCCCCCCEEEE | 56.26 | 23000965 | |
208 | Ubiquitination | DGGILCEIVKLKPKM CCCCEEEEEECCCCE | 3.02 | 32015554 | |
211 | Ubiquitination | ILCEIVKLKPKMVTM CEEEEEECCCCEEEE | 8.76 | 21963094 | |
217 | Phosphorylation | KLKPKMVTMVEIDQM ECCCCEEEEEEEEHH | 16.41 | 25002506 | |
230 | Ubiquitination | QMVIDGCKKYMRKTC HHHHHHHHHHHHHHH | 53.09 | 23000965 | |
230 (in isoform 1) | Ubiquitination | - | 53.09 | 21890473 | |
231 | Ubiquitination | MVIDGCKKYMRKTCG HHHHHHHHHHHHHHH | 48.64 | 23000965 | |
235 | Ubiquitination | GCKKYMRKTCGDVLD HHHHHHHHHHHHHHH | 31.47 | 23000965 | |
235 | 2-Hydroxyisobutyrylation | GCKKYMRKTCGDVLD HHHHHHHHHHHHHHH | 31.47 | - | |
236 | Phosphorylation | CKKYMRKTCGDVLDN HHHHHHHHHHHHHHH | 16.03 | - | |
245 | Acetylation | GDVLDNLKGDCYQVL HHHHHHCCCCHHHHH | 59.98 | 26051181 | |
245 | Ubiquitination | GDVLDNLKGDCYQVL HHHHHHCCCCHHHHH | 59.98 | 21963094 | |
258 | Ubiquitination | VLIEDCIPVLKRYAK HHHHHHHHHHHHHHH | 31.55 | 29967540 | |
261 | 2-Hydroxyisobutyrylation | EDCIPVLKRYAKEGR HHHHHHHHHHHHCCC | 43.53 | - | |
261 | Acetylation | EDCIPVLKRYAKEGR HHHHHHHHHHHHCCC | 43.53 | 26051181 | |
261 | Ubiquitination | EDCIPVLKRYAKEGR HHHHHHHHHHHHCCC | 43.53 | 32015554 | |
291 | Phosphorylation | TSPEEDSTWEFLRLI CCCCCCCHHHHHHHH | 41.14 | - | |
311 | Ubiquitination | KVLKQDGKYFTQGNC HHHHHCCCEECCCCE | 45.54 | 29967540 | |
337 | S-palmitoylation | EQLGRLYCPVEFSKE HHHCCCCCCCCCCCC | 3.44 | 29575903 | |
342 | Phosphorylation | LYCPVEFSKEIVCVP CCCCCCCCCCEEEEC | 18.84 | 21712546 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPSY_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPSY_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPSY_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CHRD1_HUMAN | CHORDC1 | physical | 22863883 | |
DX39A_HUMAN | DDX39A | physical | 22863883 | |
CH60_HUMAN | HSPD1 | physical | 22863883 | |
KYNU_HUMAN | KYNU | physical | 22863883 | |
LDHA_HUMAN | LDHA | physical | 22863883 | |
NHRF1_HUMAN | SLC9A3R1 | physical | 22863883 | |
SMAP_HUMAN | C11orf58 | physical | 22863883 | |
DHSO_HUMAN | SORD | physical | 22863883 | |
ENOPH_HUMAN | ENOPH1 | physical | 26344197 | |
VIGLN_HUMAN | HDLBP | physical | 26344197 | |
MTRR_HUMAN | MTRR | physical | 26344197 | |
UCHL3_HUMAN | UCHL3 | physical | 26344197 | |
XIAP_HUMAN | XIAP | physical | 26496610 | |
VATC1_HUMAN | ATP6V1C1 | physical | 26496610 | |
ETFA_HUMAN | ETFA | physical | 26496610 | |
STXB2_HUMAN | STXBP2 | physical | 26496610 | |
BAP1_HUMAN | BAP1 | physical | 26496610 | |
IASPP_HUMAN | PPP1R13L | physical | 26496610 | |
HEAT3_HUMAN | HEATR3 | physical | 26496610 | |
PDRG1_HUMAN | PDRG1 | physical | 26496610 | |
PRC2B_HUMAN | PRRC2B | physical | 26496610 | |
CMBL_HUMAN | CMBL | physical | 26496610 |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Immunoaffinity profiling of tyrosine phosphorylation in cancercells."; Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H.,Zha X.-M., Polakiewicz R.D., Comb M.J.; Nat. Biotechnol. 23:94-101(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-147, AND MASSSPECTROMETRY. |