UniProt ID | NKX31_HUMAN | |
---|---|---|
UniProt AC | Q99801 | |
Protein Name | Homeobox protein Nkx-3.1 | |
Gene Name | NKX3-1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 234 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells.. | |
Protein Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 | Phosphorylation | AEGAAPPTPSKPLTS CCCCCCCCCCCCHHH | 38.85 | 28122231 | |
23 | Phosphorylation | GAAPPTPSKPLTSFL CCCCCCCCCCHHHHH | 49.75 | 24719451 | |
48 | Phosphorylation | RQGGRTSSQRQRDPE HCCCCCCCCCCCCCC | 28.86 | 11980664 | |
84 | Ubiquitination | STGPRAAPEEAETLA CCCCCCCHHHHHHHH | 38.69 | 29967540 | |
89 | Phosphorylation | AAPEEAETLAETEPE CCHHHHHHHHHCCCC | 38.01 | 22817900 | |
93 | Phosphorylation | EAETLAETEPERHLG HHHHHHHCCCCHHHH | 51.76 | 22817900 | |
107 | Ubiquitination | GSYLLDSENTSGALP HHHHCCCCCCCCCCC | 65.28 | 29967540 | |
134 | Phosphorylation | SRAAFSHTQVIELER CCHHHCHHHHHHHHH | 24.27 | - | |
159 | Ubiquitination | PERAHLAKNLKLTET HHHHHHHHHCCCCHH | 69.99 | 29967540 | |
162 | Ubiquitination | AHLAKNLKLTETQVK HHHHHHCCCCHHHHH | 63.86 | - | |
166 | Phosphorylation | KNLKLTETQVKIWFQ HHCCCCHHHHHHHHH | 33.17 | - | |
182 | Ubiquitination | RRYKTKRKQLSSELG HHHHHHHHHHHHHHH | 58.09 | 29967540 | |
185 | Phosphorylation | KTKRKQLSSELGDLE HHHHHHHHHHHHHHH | 21.19 | 18757402 | |
186 | Phosphorylation | TKRKQLSSELGDLEK HHHHHHHHHHHHHHH | 45.49 | 22210691 | |
195 | Phosphorylation | LGDLEKHSSLPALKE HHHHHHHCCCHHHHH | 44.64 | 18757402 | |
196 | Phosphorylation | GDLEKHSSLPALKEE HHHHHHCCCHHHHHH | 37.78 | 18757402 | |
222 | Phosphorylation | NSYPYYPYLYCVGSW CCCCCCCEEEEEECC | 8.32 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
48 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
89 | T | Phosphorylation | Kinase | CSNK2A2 | P19784 | GPS |
89 | T | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
93 | T | Phosphorylation | Kinase | CSNK2A2 | P19784 | GPS |
134 | T | Phosphorylation | Kinase | ATM | Q13315 | PSP |
166 | T | Phosphorylation | Kinase | ATM | Q13315 | PSP |
185 | S | Phosphorylation | Kinase | DYRK1B | Q9Z188 | PSP |
185 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
186 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
195 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
196 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
- | K | Ubiquitination | E3 ubiquitin ligase | TOPORS | Q9NS56 | PMID:18077445 |
- | K | Ubiquitination | E3 ubiquitin ligase | SKP2 | Q13309 | PMID:27065334 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NKX31_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NKX31_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...