| UniProt ID | NKX31_HUMAN | |
|---|---|---|
| UniProt AC | Q99801 | |
| Protein Name | Homeobox protein Nkx-3.1 | |
| Gene Name | NKX3-1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 234 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Transcription factor, which binds preferentially the consensus sequence 5'-TAAGT[AG]-3' and can behave as a transcriptional repressor. Plays an important role in normal prostate development, regulating proliferation of glandular epithelium and in the formation of ducts in prostate. Acts as a tumor suppressor controlling prostate carcinogenesis, as shown by the ability to inhibit proliferation and invasion activities of PC-3 prostate cancer cells.. | |
| Protein Sequence | MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | AEGAAPPTPSKPLTS CCCCCCCCCCCCHHH | 38.85 | 28122231 | |
| 23 | Phosphorylation | GAAPPTPSKPLTSFL CCCCCCCCCCHHHHH | 49.75 | 24719451 | |
| 48 | Phosphorylation | RQGGRTSSQRQRDPE HCCCCCCCCCCCCCC | 28.86 | 11980664 | |
| 84 | Ubiquitination | STGPRAAPEEAETLA CCCCCCCHHHHHHHH | 38.69 | 29967540 | |
| 89 | Phosphorylation | AAPEEAETLAETEPE CCHHHHHHHHHCCCC | 38.01 | 22817900 | |
| 93 | Phosphorylation | EAETLAETEPERHLG HHHHHHHCCCCHHHH | 51.76 | 22817900 | |
| 107 | Ubiquitination | GSYLLDSENTSGALP HHHHCCCCCCCCCCC | 65.28 | 29967540 | |
| 134 | Phosphorylation | SRAAFSHTQVIELER CCHHHCHHHHHHHHH | 24.27 | - | |
| 159 | Ubiquitination | PERAHLAKNLKLTET HHHHHHHHHCCCCHH | 69.99 | 29967540 | |
| 162 | Ubiquitination | AHLAKNLKLTETQVK HHHHHHCCCCHHHHH | 63.86 | - | |
| 166 | Phosphorylation | KNLKLTETQVKIWFQ HHCCCCHHHHHHHHH | 33.17 | - | |
| 182 | Ubiquitination | RRYKTKRKQLSSELG HHHHHHHHHHHHHHH | 58.09 | 29967540 | |
| 185 | Phosphorylation | KTKRKQLSSELGDLE HHHHHHHHHHHHHHH | 21.19 | 18757402 | |
| 186 | Phosphorylation | TKRKQLSSELGDLEK HHHHHHHHHHHHHHH | 45.49 | 22210691 | |
| 195 | Phosphorylation | LGDLEKHSSLPALKE HHHHHHHCCCHHHHH | 44.64 | 18757402 | |
| 196 | Phosphorylation | GDLEKHSSLPALKEE HHHHHHCCCHHHHHH | 37.78 | 18757402 | |
| 222 | Phosphorylation | NSYPYYPYLYCVGSW CCCCCCCEEEEEECC | 8.32 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 48 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 89 | T | Phosphorylation | Kinase | CSNK2A2 | P19784 | GPS |
| 89 | T | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
| 93 | T | Phosphorylation | Kinase | CSNK2A2 | P19784 | GPS |
| 134 | T | Phosphorylation | Kinase | ATM | Q13315 | PSP |
| 166 | T | Phosphorylation | Kinase | ATM | Q13315 | PSP |
| 185 | S | Phosphorylation | Kinase | DYRK1B | Q9Z188 | PSP |
| 185 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
| 186 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
| 195 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
| 196 | S | Phosphorylation | Kinase | PIM1 | P11309 | PSP |
| - | K | Ubiquitination | E3 ubiquitin ligase | TOPORS | Q9NS56 | PMID:18077445 |
| - | K | Ubiquitination | E3 ubiquitin ligase | SKP2 | Q13309 | PMID:27065334 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NKX31_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NKX31_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...