UniProt ID | SP5_HUMAN | |
---|---|---|
UniProt AC | Q6BEB4 | |
Protein Name | Transcription factor Sp5 | |
Gene Name | SP5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 398 | |
Subcellular Localization | Nucleus. | |
Protein Description | Binds to GC boxes promoters elements. Probable transcriptional activator that has a role in the coordination of changes in transcription required to generate pattern in the developing embryo (By similarity).. | |
Protein Sequence | MAAVAVLRNDSLQAFLQDRTPSASPDLGKHSPLALLAATCSRIGQPGAAAPPDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKMLPSSMAALPASCAPAYVPYAAQAALPPGYSNLLPPPPPPPPPPTCRQLSPNPAPDDLPWWSIPQAGAGPGASGVPGSGLSGACAGAPHAPRFPASAAAAAAAAAALQRGLVLGPSDFAQYQSQIAALLQTKAPLAATARRCRRCRCPNCQAAGGAPEAEPGKKKQHVCHVPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKSFTRSDELQRHLRTHTGEKRFACPECGKRFMRSDHLAKHVKTHQNKKLKVAEAGVKREDARDL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | VAVLRNDSLQAFLQD EEEECCHHHHHHHHC | 26.40 | 23312004 | |
20 | Phosphorylation | QAFLQDRTPSASPDL HHHHHCCCCCCCCCC | 29.86 | 23312004 | |
22 | Phosphorylation | FLQDRTPSASPDLGK HHHCCCCCCCCCCCC | 40.54 | 23312004 | |
24 | Phosphorylation | QDRTPSASPDLGKHS HCCCCCCCCCCCCCC | 24.24 | 29802988 | |
31 | Phosphorylation | SPDLGKHSPLALLAA CCCCCCCCHHHHHHH | 25.70 | 23312004 | |
39 | Phosphorylation | PLALLAATCSRIGQP HHHHHHHHHHHHCCC | 12.85 | 23312004 | |
41 | Phosphorylation | ALLAATCSRIGQPGA HHHHHHHHHHCCCCC | 23.68 | 23312004 | |
59 | Phosphorylation | PDFLQVPYDPALGSP CCCCCCCCCCCCCCC | 35.38 | 25999147 | |
65 | Phosphorylation | PYDPALGSPSRLFHP CCCCCCCCCCHHCCC | 22.13 | 27050516 | |
95 | Phosphorylation | PHPSLGLTPQKTHLQ CCCCCCCCCCCCCCC | 23.13 | 24719451 | |
99 | Phosphorylation | LGLTPQKTHLQPSFG CCCCCCCCCCCCCCC | 23.67 | 23312004 | |
104 | Phosphorylation | QKTHLQPSFGAAHEL CCCCCCCCCCCCCCC | 24.29 | 23312004 | |
114 | Phosphorylation | AAHELPLTPPADPSY CCCCCCCCCCCCCCC | 25.86 | 23312004 | |
120 | Phosphorylation | LTPPADPSYPYEFSP CCCCCCCCCCCCCCC | 39.01 | 23312004 | |
121 | Phosphorylation | TPPADPSYPYEFSPV CCCCCCCCCCCCCCC | 18.41 | 23312004 | |
123 | Phosphorylation | PADPSYPYEFSPVKM CCCCCCCCCCCCCCC | 22.75 | 23312004 | |
126 | Phosphorylation | PSYPYEFSPVKMLPS CCCCCCCCCCCCCCH | 19.49 | 23312004 | |
225 | Phosphorylation | HAPRFPASAAAAAAA CCCCCCHHHHHHHHH | 20.76 | - | |
321 | Phosphorylation | KAHLRWHTGERPFVC HHHHHHCCCCCCEEE | 33.50 | - | |
338 | Phosphorylation | LFCGKSFTRSDELQR EEECCCCCCCHHHHH | 36.03 | 26278961 | |
340 | Phosphorylation | CGKSFTRSDELQRHL ECCCCCCCHHHHHHH | 32.17 | 29496963 | |
349 | Phosphorylation | ELQRHLRTHTGEKRF HHHHHHHHCCCCCCE | 30.10 | - | |
351 | Phosphorylation | QRHLRTHTGEKRFAC HHHHHHCCCCCCEEC | 46.56 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SP5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SP5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SP5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of SP5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...