| UniProt ID | NAB2_SCHPO | |
|---|---|---|
| UniProt AC | O13713 | |
| Protein Name | Nuclear polyadenylated RNA-binding protein nab2 | |
| Gene Name | nab2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 307 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Binds to polyadenylated RNA and single-stranded DNA. It may be involved not only in RNA processing but also in transcription regulation. Believed to associate directly with nascent RNA polymerase II transcripts and remain associated during subsequent nuclear RNA processing reactions (By similarity).. | |
| Protein Sequence | MTTLLETPGYSEKLHDSIEKKLSEYGWGEEAASLADFVLVMLSNGKTQTEINEELVDLIGSDFDTSFSLWLFNQIEELEKSKNASVESVSKIDEIDFIEKESTDKSQQSFSVPETSIQPQSSQTPNITSLREEKELPTGRVGQKLKLTSQKQRFNPMAASFNYSKSVMPAAKRALTQTQEVPLCKYADKCSRANCIFAHPTPAAAPGEGMVLSSEMCASGKECKAADCVKGHPSPATVTTLPPFMSMSTIPIPCKYKPCLNPACRFIHPTKSRNMTWRPPSKTEETSLSERSFAVNESEEQLHVPSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 85 | Phosphorylation | LEKSKNASVESVSKI HHHHCCCCHHHHHHH | 35.49 | 25720772 | |
| 88 | Phosphorylation | SKNASVESVSKIDEI HCCCCHHHHHHHHCC | 29.54 | 25720772 | |
| 106 | Phosphorylation | EKESTDKSQQSFSVP ECCCCCCHHCCCCCC | 35.94 | 21712547 | |
| 121 | Phosphorylation | ETSIQPQSSQTPNIT CCCCCCCCCCCCCCC | 30.97 | 21712547 | |
| 289 | Phosphorylation | KTEETSLSERSFAVN CCCCCCHHHCEEECC | 30.63 | 25720772 | |
| 298 | Phosphorylation | RSFAVNESEEQLHVP CEEECCCCHHHHCCC | 41.03 | 24763107 | |
| 306 | Phosphorylation | EEQLHVPSV------ HHHHCCCCC------ | 39.09 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NAB2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NAB2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NAB2_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
