NHP2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NHP2_SCHPO
• UniProt AC: Q9P7H0
• Protein Name: H/ACA ribonucleoprotein complex subunit nhp2
• Gene Name: nhp2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 154
• Subcellular Localization: Nucleus, nucleolus .
• Protein Description: Non-catalytic component of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP), which catalyzes pseudouridylation of rRNA and is required for ribosome biogenesis. [PubMed: 10502409 This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1 (By similarity Pseudouridine ("psi") residues may serve to stabilize the conformation of rRNAs (By similarity The H/ACA snoRNP complex also mediates pseudouridylation of other types of RNAs (By similarity The H/ACA snoRNP complex mediates pseudouridylation at position 93 in U2 snRNA (By similarity Directly binds H/ACA snoRNAs (By similarity]
• Protein Sequence: MAKDKKDHKHSGSTEDEYDSYLPALMPIAKPLAPKKLNKKMMKTVKKASKQKHILRGVKEVVKAVRKGEKGLVILAGDISPMDVISHIPVLCEDNNVPYLYTVSKELLGEASNTKRPTSCVMIVPGGKKKDMSKVEEYKESYEEIIKEVPALEV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	DKKDHKHSGSTEDEY CCCCCCCCCCCHHHH	38.96	27738172
119	Phosphorylation	SNTKRPTSCVMIVPG CCCCCCCEEEEEECC	13.85	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NHP2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NHP2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NHP2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARP6_SCHPO	arp6	genetic	22681890
YAOF_SCHPO	SPAC11D3.15	genetic	22681890
HIS1_SCHPO	his1	genetic	22681890
YIDH_SCHPO	SPAC227.17c	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY.
PubMed: 18257517