| UniProt ID | MRX7_YEAST | |
|---|---|---|
| UniProt AC | P53869 | |
| Protein Name | MIOREX complex component 7 {ECO:0000305|PubMed:25683707} | |
| Gene Name | MRX7 {ECO:0000303|PubMed:25683707} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 86 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Component of MIOREX complexes, large expressome-like assemblies of ribosomes with factors involved in all the steps of post-transcriptional gene expression.. | |
| Protein Sequence | MPPRSIEEWFYYKLLSSPGFHRFVRKVYRKVNGIKEDPFTDQSTAFQYLYKPTPRQKFKALRLLFWDEMRSTFGFRRRLGDRFKKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of MRX7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRX7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRX7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRX7_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MAK5_YEAST | MAK5 | genetic | 27708008 | |
| CDC37_YEAST | CDC37 | genetic | 27708008 | |
| DPOD2_YEAST | POL31 | genetic | 27708008 | |
| MED14_YEAST | RGR1 | genetic | 27708008 | |
| CDC53_YEAST | CDC53 | genetic | 27708008 | |
| TFB1_YEAST | TFB1 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| STT3_YEAST | STT3 | genetic | 27708008 | |
| MCE1_YEAST | CEG1 | genetic | 27708008 | |
| SAM35_YEAST | SAM35 | genetic | 27708008 | |
| MET30_YEAST | MET30 | genetic | 27708008 | |
| SMC3_YEAST | SMC3 | genetic | 27708008 | |
| CDC6_YEAST | CDC6 | genetic | 27708008 | |
| NEP1_YEAST | EMG1 | genetic | 27708008 | |
| RU1C_YEAST | YHC1 | genetic | 27708008 | |
| UTP15_YEAST | UTP15 | genetic | 27708008 | |
| PRP24_YEAST | PRP24 | genetic | 27708008 | |
| NOP2_YEAST | NOP2 | genetic | 27708008 | |
| SEC12_YEAST | SEC12 | genetic | 27708008 | |
| MVD1_YEAST | MVD1 | genetic | 27708008 | |
| HRP1_YEAST | HRP1 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 | |
| DYR_YEAST | DFR1 | genetic | 27708008 | |
| NIP7_YEAST | NIP7 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
