MPK6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPK6_ARATH
• UniProt AC: Q39026
• Protein Name: Mitogen-activated protein kinase 6
• Gene Name: MPK6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 395
• Subcellular Localization: Cytoplasm. Nucleus. Translocated into the nucleus in response to phosphorylation.
• Protein Description: Involved in oxidative stress-mediated signaling cascade (such as ozone). Involved in the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6) downstream of bacterial flagellin receptor FLS2. May be involved in hypersensitive response (HR)-mediated signaling cascade by modulating LIP5 phosphorylation and subsequent multivesicular bodies (MVBs) trafficking. May phosphorylate regulators of WRKY transcription factors. Phosphorylates 1-aminocyclopropane-1-carboxylic acid synthases (ACS2 and ACS6) and may be involved in the regulation of bacterial elicitor flagellin-induced ethylene production. Regulates locally gene-mediated and basal resistance response to certain pathogens. May be involved in the cold and salinity stress-mediated MAP kinase signaling cascade (MEKK1, MKK1/MKK2 and MPK4/MPK6). MKK1-MPK6 module mediates abscisic acid (ABA)-dependent CAT1 expression with H(2)O(2) production and response to drought and salt stress. MKK1-MPK6 module is also involved in sugar signaling during the process of seed germination. MKK3-MPK6 module plays an important role in the jasmonate signal transduction pathway through the negative regulation of MYC2/JIN1 expression. MKK9-MPK3/MPK6 module phosphorylates and activates EIN3, leading to the promotion of EIN3-mediated transcription in ethylene signaling. MPK3/MPK6 cascade regulates camalexin synthesis through transcriptional regulation of the biosynthetic genes after pathogen infection. MKK9-MPK6 module positively regulates leaf senescence. YDA-MKK4/MKK5-MPK3/MPK6 module regulates stomatal cell fate before the guard mother cell (GMC) is specified. This MAPK cascade also functions downstream of the ER receptor in regulating coordinated local cell proliferation, which shapes the morphology of plant organs..
• Protein Sequence: MDGGSGQPAADTEMTEAPGGFPAAAPSPQMPGIENIPATLSHGGRFIQYNIFGNIFEVTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHMDHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKRYIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDEPECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
215	Phosphorylation	FGLARVTSESDFMTE CCCCEECCCCHHHHH	32.04	23776212
217	Phosphorylation	LARVTSESDFMTEYV CCEECCCCHHHHHHH	35.60	23776212
221	Phosphorylation	TSESDFMTEYVVTRW CCCCHHHHHHHHHEE	24.94	27532006
223	Phosphorylation	ESDFMTEYVVTRWYR CCHHHHHHHHHEEEC	7.34	27532006
226	Phosphorylation	FMTEYVVTRWYRAPE HHHHHHHHEEECCHH	12.87	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPK6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
221	T	Phosphorylation	Dually phosphorylated on Thr-221 and Tyr-223, which activates the enzyme.	10713056

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPK6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPK1_ARATH	MPK1	physical	12456655
MPK1_ARATH	MPK1	physical	19789277
PTP1_ARATH	PTP1	physical	19789277
NIA1_ARATH	NIA1	physical	20870959
NIA2_ARATH	NIA2	physical	20870959
Y2706_ARATH	AT2G47060	physical	21276203
OXI1_ARATH	AGC2-1	physical	21276203
MKP1_ARATH	MKP1	physical	21455789
ZAT10_ARATH	STZ	physical	22134874
EF103_ARATH	ERF6	physical	23300166
ERLL1_ARATH	AZI1	physical	24214892
EF104_ARATH	ERF104	physical	19416906
BZR2_ARATH	BES1	physical	25609555
MYC2_ARATH	MYC2	physical	25139007
MYC2_ARATH	MYC2	genetic	25139007
GBB_ARATH	AGB1	physical	25635681
HFA4A_ARATH	HSF A4A	physical	24676858
P2C25_ARATH	AT2G30020	physical	17630279
TBG1_ARATH	TUBG1	physical	26061286
EB1C_ARATH	EB1C	physical	26061286
MPK6_ARATH	MPK6	physical	25969537

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteomic analysis of nuclei-enriched fractions fromArabidopsis thaliana.";
Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A.,Andreasson E., Rathjen J.P., Peck S.C.;
J. Proteomics 72:439-451(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-221, SUBCELLULARLOCATION, AND MASS SPECTROMETRY.
PubMed: 19245862