MPK1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPK1_ARATH
• UniProt AC: Q39021
• Protein Name: Mitogen-activated protein kinase 1
• Gene Name: MPK1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 370
• Protein Sequence: MATLVDPPNGIRNEGKHYFSMWQTLFEIDTKYMPIKPIGRGAYGVVCSSVNSDTNEKVAIKKIHNVYENRIDALRTLRELKLLRHLRHENVIALKDVMMPIHKMSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLARASNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFQGTECLNQLKLIVNILGSQREEDLEFIDNPKAKRYIRSLPYSPGMSLSRLYPGAHVLAIDLLQKMLVFDPSKRISVSEALQHPYMAPLYDPNANPPAQVPIDLDVDEDLREEMIREMMWNEMLHYHPQASTLNTEL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
191	Phosphorylation	NTKGQFMTEYVVTRW CCCCCCHHHHHHHEE	26.00	29654922
193	Phosphorylation	KGQFMTEYVVTRWYR CCCCHHHHHHHEECC	7.34	22074104
196	Phosphorylation	FMTEYVVTRWYRAPE CHHHHHHHEECCCCH	12.87	22074104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPK1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
191	T	Phosphorylation	Dually phosphorylated on Thr-191 and Tyr-193, which activates the enzyme (By similarity).	8130795

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPK1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MPK3_ARATH	MPK3	physical	12456655
MPK4_ARATH	MPK4	physical	12456655
MPK6_ARATH	MPK6	physical	12456655

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.