UniProt ID | MPK1_ARATH | |
---|---|---|
UniProt AC | Q39021 | |
Protein Name | Mitogen-activated protein kinase 1 | |
Gene Name | MPK1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 370 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MATLVDPPNGIRNEGKHYFSMWQTLFEIDTKYMPIKPIGRGAYGVVCSSVNSDTNEKVAIKKIHNVYENRIDALRTLRELKLLRHLRHENVIALKDVMMPIHKMSFKDVYLVYELMDTDLHQIIKSSQVLSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLARASNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFQGTECLNQLKLIVNILGSQREEDLEFIDNPKAKRYIRSLPYSPGMSLSRLYPGAHVLAIDLLQKMLVFDPSKRISVSEALQHPYMAPLYDPNANPPAQVPIDLDVDEDLREEMIREMMWNEMLHYHPQASTLNTEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
191 | Phosphorylation | NTKGQFMTEYVVTRW CCCCCCHHHHHHHEE | 26.00 | 29654922 | |
193 | Phosphorylation | KGQFMTEYVVTRWYR CCCCHHHHHHHEECC | 7.34 | 22074104 | |
196 | Phosphorylation | FMTEYVVTRWYRAPE CHHHHHHHEECCCCH | 12.87 | 22074104 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPK1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
191 | T | Phosphorylation |
| 8130795 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPK1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPK3_ARATH | MPK3 | physical | 12456655 | |
MPK4_ARATH | MPK4 | physical | 12456655 | |
MPK6_ARATH | MPK6 | physical | 12456655 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...