MPK4_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MPK4_ARATH
• UniProt AC: Q39024
• Protein Name: Mitogen-activated protein kinase 4
• Gene Name: MPK4
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 376
• Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, cytoskeleton. Translocated into the nucleus in response to phosphorylation (Probable). Localized to the cell plate.
• Protein Description: The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis. Essential to promote the progression of cytokinesis and for cellularization (formation of the cell plate) during male-specific meiosis. Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule-associated proteins such as MAP65-1. Involved in root hair development process. Negative regulator of systemic acquired resistance (SAR) and salicylic acid- (SA) mediated defense response. Required for jasmonic acid- (JA) mediated defense gene expression. May regulate activity of transcription factor controlling pathogenesis-related (PR) gene expression. Seems to act independently of the SAR regulatory protein NPR1 (Nonexpresser of PR1). Phosphorylates MKS1 and transcription factors WRKY25 and WRKY33. The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity. [PubMed: 11163186]
• Protein Sequence: MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNPQDSV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSAESCFGS ------CCCCCCCCC	40.52	25561503
5	Phosphorylation	---MSAESCFGSSGD ---CCCCCCCCCCCC	17.92	25561503
193	Phosphorylation	GDFGLARTKSETDFM CCCCCCCCCCCCCHH	33.06	23776212
195	Phosphorylation	FGLARTKSETDFMTE CCCCCCCCCCCHHHH	45.15	23776212
197	Phosphorylation	LARTKSETDFMTEYV CCCCCCCCCHHHHHH	41.44	23776212
201	Phosphorylation	KSETDFMTEYVVTRW CCCCCHHHHHHHHHC	24.94	23776212
203	Phosphorylation	ETDFMTEYVVTRWYR CCCHHHHHHHHHCCC	7.34	24601666
206	Phosphorylation	FMTEYVVTRWYRAPE HHHHHHHHHCCCCHH	12.87	24243849
375	Phosphorylation	VKFNPQDSV------ CCCCCCCCC------	25.20	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MPK4_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
201	T	Phosphorylation	Dually phosphorylated on Thr-201 and Tyr-203, which activates the enzyme.	11163186

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MPK4_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
M2K1_ARATH	MEK1	physical	18982020
M2K2_ARATH	MKK2	physical	18982020
M3K1_ARATH	MEKK1	physical	9878570
M2K2_ARATH	MKK2	physical	9878570
MKS1_ARATH	MKS1	physical	21203436
M3K1_ARATH	MEKK1	physical	21575092
M2K6_ARATH	MKK6	physical	21575092
MPK4_ARATH	MPK4	physical	19392697
P2C25_ARATH	AT2G30020	physical	17630279
MPK4_ARATH	MPK4	physical	25969537

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.