UniProt ID | MPK4_ARATH | |
---|---|---|
UniProt AC | Q39024 | |
Protein Name | Mitogen-activated protein kinase 4 | |
Gene Name | MPK4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 376 | |
Subcellular Localization | Cytoplasm. Nucleus. Cytoplasm, cytoskeleton. Translocated into the nucleus in response to phosphorylation (Probable). Localized to the cell plate. | |
Protein Description | The ANPs-MKK6-MPK4 module is involved in the regulation of plant cytokinesis during meiosis and mitosis. Essential to promote the progression of cytokinesis and for cellularization (formation of the cell plate) during male-specific meiosis. Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule-associated proteins such as MAP65-1. Involved in root hair development process. Negative regulator of systemic acquired resistance (SAR) and salicylic acid- (SA) mediated defense response. Required for jasmonic acid- (JA) mediated defense gene expression. May regulate activity of transcription factor controlling pathogenesis-related (PR) gene expression. Seems to act independently of the SAR regulatory protein NPR1 (Nonexpresser of PR1). Phosphorylates MKS1 and transcription factors WRKY25 and WRKY33. The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity. [PubMed: 11163186] | |
Protein Sequence | MSAESCFGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAIKKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIRSNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHPYLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKFNPQDSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSAESCFGS ------CCCCCCCCC | 40.52 | 25561503 | |
5 | Phosphorylation | ---MSAESCFGSSGD ---CCCCCCCCCCCC | 17.92 | 25561503 | |
193 | Phosphorylation | GDFGLARTKSETDFM CCCCCCCCCCCCCHH | 33.06 | 23776212 | |
195 | Phosphorylation | FGLARTKSETDFMTE CCCCCCCCCCCHHHH | 45.15 | 23776212 | |
197 | Phosphorylation | LARTKSETDFMTEYV CCCCCCCCCHHHHHH | 41.44 | 23776212 | |
201 | Phosphorylation | KSETDFMTEYVVTRW CCCCCHHHHHHHHHC | 24.94 | 23776212 | |
203 | Phosphorylation | ETDFMTEYVVTRWYR CCCHHHHHHHHHCCC | 7.34 | 24601666 | |
206 | Phosphorylation | FMTEYVVTRWYRAPE HHHHHHHHHCCCCHH | 12.87 | 24243849 | |
375 | Phosphorylation | VKFNPQDSV------ CCCCCCCCC------ | 25.20 | 29654922 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPK4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
201 | T | Phosphorylation |
| 11163186 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPK4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
M2K1_ARATH | MEK1 | physical | 18982020 | |
M2K2_ARATH | MKK2 | physical | 18982020 | |
M3K1_ARATH | MEKK1 | physical | 9878570 | |
M2K2_ARATH | MKK2 | physical | 9878570 | |
MKS1_ARATH | MKS1 | physical | 21203436 | |
M3K1_ARATH | MEKK1 | physical | 21575092 | |
M2K6_ARATH | MKK6 | physical | 21575092 | |
MPK4_ARATH | MPK4 | physical | 19392697 | |
P2C25_ARATH | AT2G30020 | physical | 17630279 | |
MPK4_ARATH | MPK4 | physical | 25969537 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...