UniProt ID | M3K1_ARATH | |
---|---|---|
UniProt AC | Q39008 | |
Protein Name | Mitogen-activated protein kinase kinase kinase 1 | |
Gene Name | MEKK1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 608 | |
Subcellular Localization | Cell membrane . Endosome . | |
Protein Description | The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity. Involved in the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6) downstream of bacterial flagellin receptor FLS2. May be involved in the cold and salinity stress-mediated MAP kinase signaling cascade (MEKK1, MKK1/MKK2 and MPK4/MPK6). Activates by phosphorylation the downstream MKK2, MKK4 and MKK5 in a calcium-dependent manner.. | |
Protein Sequence | MDRILARMKKSTGRRGGDKNITPVRRLERRDAARNINYDAASCSSSSAEDLSVSTSSLMTRSLEFPEPTSFRIGGGVGEMDRIYRSLGVSGPDDLAISFDAWEACKKRSSSDVVNRFKSFDLDKVRDQDLSEEGPSGVVVGSDSMNHKVQGQDLSEAGPSGGIVTELSEIGNLITPVDRLVADGVVENRRVMERTPTIVKSKGYLVPNNVVAVGVGVGGGIKGLRPPVLKPPPAMKRPPIDHRGSSWDFLTHFAPSETVKRPSSSSSSSEDGCDEEEGKEEEAEAEEMGARFIQLGDTADETCSFTTNEGDSSSTVSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVRRPLPSVGSGGSGSASPLLRR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | TSSLMTRSLEFPEPT HHHHHHCCCCCCCCC | 24.08 | 23776212 | |
69 | Phosphorylation | SLEFPEPTSFRIGGG CCCCCCCCCEECCCC | 38.54 | 23776212 | |
70 | Phosphorylation | LEFPEPTSFRIGGGV CCCCCCCCEECCCCH | 24.20 | 23776212 | |
109 | Phosphorylation | WEACKKRSSSDVVNR HHHHHHCCCHHHHHH | 42.97 | 25561503 | |
110 | Phosphorylation | EACKKRSSSDVVNRF HHHHHCCCHHHHHHH | 34.29 | 25561503 | |
111 | Phosphorylation | ACKKRSSSDVVNRFK HHHHCCCHHHHHHHH | 35.35 | 25561503 | |
119 | Phosphorylation | DVVNRFKSFDLDKVR HHHHHHHHCCHHHHC | 22.68 | 30291188 | |
603 | Phosphorylation | SGGSGSASPLLRR-- CCCCCCCCCCCCC-- | 20.13 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of M3K1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of M3K1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of M3K1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
M2K1_ARATH | MEK1 | physical | 18982020 | |
M2K2_ARATH | MKK2 | physical | 18982020 | |
MPK4_ARATH | MPK4 | physical | 9878570 | |
M2K1_ARATH | MEK1 | physical | 9878570 | |
M2K1_ARATH | MEK1 | physical | 9804171 | |
WRK53_ARATH | WRKY53 | physical | 17587183 | |
GBLPA_ARATH | ATARCA | physical | 25731164 | |
GPLPB_ARATH | RACK1B_AT | physical | 25731164 | |
GPLPC_ARATH | RACK1C_AT | physical | 25731164 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...