M3K1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: M3K1_ARATH
• UniProt AC: Q39008
• Protein Name: Mitogen-activated protein kinase kinase kinase 1
• Gene Name: MEKK1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 608
• Subcellular Localization: Cell membrane . Endosome .
• Protein Description: The MEKK1, MKK1/MKK2 and MPK4 function in a signaling pathway that modulates the expression of genes responding to biotic and abiotic stresses and also plays an important role in pathogen defense by negatively regulating innate immunity. Involved in the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6) downstream of bacterial flagellin receptor FLS2. May be involved in the cold and salinity stress-mediated MAP kinase signaling cascade (MEKK1, MKK1/MKK2 and MPK4/MPK6). Activates by phosphorylation the downstream MKK2, MKK4 and MKK5 in a calcium-dependent manner..
• Protein Sequence: MDRILARMKKSTGRRGGDKNITPVRRLERRDAARNINYDAASCSSSSAEDLSVSTSSLMTRSLEFPEPTSFRIGGGVGEMDRIYRSLGVSGPDDLAISFDAWEACKKRSSSDVVNRFKSFDLDKVRDQDLSEEGPSGVVVGSDSMNHKVQGQDLSEAGPSGGIVTELSEIGNLITPVDRLVADGVVENRRVMERTPTIVKSKGYLVPNNVVAVGVGVGGGIKGLRPPVLKPPPAMKRPPIDHRGSSWDFLTHFAPSETVKRPSSSSSSSEDGCDEEEGKEEEAEAEEMGARFIQLGDTADETCSFTTNEGDSSSTVSNTSPIYPDGGAIITSWQKGQLLGRGSFGSVYEGISGDGDFFAVKEVSLLDQGSQAQECIQQLEGEIKLLSQLQHQNIVRYRGTAKDGSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLYTRQILDGLKYLHDKGFIHRDIKCANILVDANGAVKLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARLFILKCLKVNPEERPTAAELLNHPFVRRPLPSVGSGGSGSASPLLRR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	TSSLMTRSLEFPEPT HHHHHHCCCCCCCCC	24.08	23776212
69	Phosphorylation	SLEFPEPTSFRIGGG CCCCCCCCCEECCCC	38.54	23776212
70	Phosphorylation	LEFPEPTSFRIGGGV CCCCCCCCEECCCCH	24.20	23776212
109	Phosphorylation	WEACKKRSSSDVVNR HHHHHHCCCHHHHHH	42.97	25561503
110	Phosphorylation	EACKKRSSSDVVNRF HHHHHCCCHHHHHHH	34.29	25561503
111	Phosphorylation	ACKKRSSSDVVNRFK HHHHCCCHHHHHHHH	35.35	25561503
119	Phosphorylation	DVVNRFKSFDLDKVR HHHHHHHHCCHHHHC	22.68	30291188
603	Phosphorylation	SGGSGSASPLLRR-- CCCCCCCCCCCCC--	20.13	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of M3K1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of M3K1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of M3K1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
M2K1_ARATH	MEK1	physical	18982020
M2K2_ARATH	MKK2	physical	18982020
MPK4_ARATH	MPK4	physical	9878570
M2K1_ARATH	MEK1	physical	9878570
M2K1_ARATH	MEK1	physical	9804171
WRK53_ARATH	WRKY53	physical	17587183
GBLPA_ARATH	ATARCA	physical	25731164
GPLPB_ARATH	RACK1B_AT	physical	25731164
GPLPC_ARATH	RACK1C_AT	physical	25731164

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.