dbPTM

ERLL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERLL1_ARATH
UniProt AC	Q9SU35
Protein Name	pEARLI1-like lipid transfer protein 1
Gene Name	AZI1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	161
Subcellular Localization	Secreted, cell wall. Endoplasmic reticulum . Cell junction, plasmodesma .
Protein Description	Probable lipid transfer protein (LTP). Seems to control the flowering process and lignin synthesis. Together with DIR1, required for glycerol-3-phosphate- (G3P) and azelaic acid- (AA) induced systemic acquired resistance (SAR). Component of plant systemic immunity involved in priming defenses in a AA-dependent manner, by modulating production and/or translocation of a mobile signal(s) during SAR. Confers resistance to Botrytis cinerea and Pseudomonas syringae pv. tomato DC3000 and PmaDG3. May be involved in induced systemic resistance (ISR) mediated by non-pathogenic bacteria (e.g. P. fluorescens GM30). Prevents electrolyte leakage during freezing damage..
Protein Sequence	MASKNSASLALFFALNILFFTLTVATNCNCKPSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTPPRTPGSSGNSCPIDALKLGVCANVLSSLLNIQLGQPSSQQCCSLIQGLVDVDAAICLCTALRANVLGINLNVPISLSVLLNVCNRKLPSGFQCA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ERLL1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERLL1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERLL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERLL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ERLL1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERLL1_ARATH

Related Literatures of Post-Translational Modification