dbPTM

ZAT10_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ZAT10_ARATH
UniProt AC	Q96289
Protein Name	Zinc finger protein ZAT10
Gene Name	ZAT10
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	227
Subcellular Localization	Nucleus .
Protein Description	Transcriptional repressor involved in abiotic stress responses. Can repress the stress responsive genes DREB1A and LTI78. Probably involved in jasmonate (JA) early signaling response. May regulate the expression of the JA biosynthesis gene LOX3 and control the expression of TIFY10A/JAZ1, a key repressor in the JA signaling cascade..
Protein Sequence	MALEALTSPRLASPIPPLFEDSSVFHGVEHWTKGKRSKRSRSDFHHQNLTEEEYLAFCLMLLARDNRQPPPPPAVEKLSYKCSVCDKTFSSYQALGGHKASHRKNLSQTLSGGGDDHSTSSATTTSAVTTGSGKSHVCTICNKSFPSGQALGGHKRCHYEGNNNINTSSVSNSEGAGSTSHVSSSHRGFDLNIPPIPEFSMVNGDDEVMSPMPAKKPRFDFPVKLQL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
7	Phosphorylation	-MALEALTSPRLASP -CCHHHHCCCCCCCC	43.67	30589143
8	Phosphorylation	MALEALTSPRLASPI CCHHHHCCCCCCCCC	14.63	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ZAT10_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ZAT10_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ZAT10_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
MPK3_ARATH	MPK3	physical	22134874
MPK6_ARATH	MPK6	physical	22134874

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ZAT10_ARATH

Related Literatures of Post-Translational Modification