UniProt ID | MESD_DROME | |
---|---|---|
UniProt AC | Q8T9B6 | |
Protein Name | LDLR chaperone boca | |
Gene Name | boca | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 180 | |
Subcellular Localization | Endoplasmic reticulum . | |
Protein Description | Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wg pathway, since some LDLRs are coreceptors for the canonical Wnt pathway.. | |
Protein Sequence | MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPGVNAKKDEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
38 | Phosphorylation | KKDIRDYSEADLERL CCCHHCCCHHHHHHH | 30.51 | 22817900 | |
78 | Phosphorylation | LDLSNLDSKSPEDLL CCCCCCCCCCHHHHH | 37.89 | 27794539 | |
80 | Phosphorylation | LSNLDSKSPEDLLKV CCCCCCCCHHHHHHH | 37.16 | 27794539 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MESD_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MESD_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MESD_DROME !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...