dbPTM

MESD_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MESD_DROME
UniProt AC	Q8T9B6
Protein Name	LDLR chaperone boca
Gene Name	boca
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	180
Subcellular Localization	Endoplasmic reticulum .
Protein Description	Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wg pathway, since some LDLRs are coreceptors for the canonical Wnt pathway..
Protein Sequence	MQTRLVLLLLALTPLVLAKKFKEEEKPAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPGVNAKKDEL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
38	Phosphorylation	KKDIRDYSEADLERL CCCHHCCCHHHHHHH	30.51	22817900
78	Phosphorylation	LDLSNLDSKSPEDLL CCCCCCCCCCHHHHH	37.89	27794539
80	Phosphorylation	LSNLDSKSPEDLLKV CCCCCCCCHHHHHHH	37.16	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MESD_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MESD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MESD_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CPSF6_DROME	CG7185	physical	22036573
YC17_DROME	CG16817	physical	22036573
MED17_DROME	MED17	physical	22036573
MED18_DROME	MED18	physical	22036573
MED8_DROME	MED8	physical	22036573
MED11_DROME	MED11	physical	22036573
TCPG_DROME	Cctgamma	physical	22036573
MED10_DROME	MED10	physical	22036573
IDH3A_DROME	l(1)G0156	physical	22036573
MED14_DROME	MED14	physical	22036573
EBI_DROME	ebi	physical	22036573
MED30_DROME	MED30	physical	22036573
MED27_DROME	MED27	physical	22036573
TERA_DROME	TER94	physical	22036573
MED6_DROME	MED6	physical	22036573
NACA_DROME	Nacalpha	physical	22036573
MED7_DROME	MED7	physical	22036573
MED20_DROME	MED20	physical	22036573
CP9B2_DROME	Cyp9b2	physical	22036573
MED4_DROME	MED4	physical	22036573
BAP60_DROME	Bap60	physical	22036573
EIF3J_DROME	Adam	physical	22036573
MED16_DROME	MED16	physical	22036573
MED15_DROME	MED15	physical	22036573
MED23_DROME	MED23	physical	22036573
SPTCA_DROME	alpha-Spec	physical	22036573
CARM1_DROME	Art4	physical	22036573
BMT2_DROME	CG3570	physical	22036573
CDK8_DROME	Cdk8	physical	22036573
BI1_DROME	BI-1	physical	22036573
Y1505_DROME	CG11505	physical	22036573
CSN4_DROME	CSN4	physical	22036573
RS19A_DROME	RpS19a	physical	22036573
RS10B_DROME	RpS10b	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MESD_DROME

Related Literatures of Post-Translational Modification