UniProt ID | RS19A_DROME | |
---|---|---|
UniProt AC | P39018 | |
Protein Name | 40S ribosomal protein S19a | |
Gene Name | RpS19a | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 156 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQIVFKQRDAAKQTGPIVISK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
124 | Phosphorylation | PDGGRKLSSIGQRDL CCCCCCCHHHCHHHH | 23.97 | 21082442 | |
149 | Phosphorylation | QRDAAKQTGPIVISK HHHHHHHHCCEEEEC | 44.19 | 21082442 | |
155 | Phosphorylation | QTGPIVISK------ HHCCEEEEC------ | 22.78 | 27794539 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS19A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS19A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS19A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RS10B_DROME | RpS10b | physical | 22036573 | |
GRK_DROME | grk | physical | 23213441 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...