RS19A_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS19A_DROME
• UniProt AC: P39018
• Protein Name: 40S ribosomal protein S19a
• Gene Name: RpS19a
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 156
• Protein Sequence: MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDPDWFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHARLVEKHPDGGRKLSSIGQRDLDRIANQIVFKQRDAAKQTGPIVISK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	PDGGRKLSSIGQRDL CCCCCCCHHHCHHHH	23.97	21082442
149	Phosphorylation	QRDAAKQTGPIVISK HHHHHHHHCCEEEEC	44.19	21082442
155	Phosphorylation	QTGPIVISK------ HHCCEEEEC------	22.78	27794539

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS19A_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS19A_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS19A_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RS10B_DROME	RpS10b	physical	22036573
GRK_DROME	grk	physical	23213441

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.