CP9B2_DROME - dbPTM
CP9B2_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID CP9B2_DROME
UniProt AC Q9V4I1
Protein Name Cytochrome P450 9b2
Gene Name Cyp9b2
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 505
Subcellular Localization Endoplasmic reticulum membrane
Peripheral membrane protein . Microsome membrane
Peripheral membrane protein .
Protein Description May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides..
Protein Sequence MALIEICLALVVIGYLIYKWSTATFKTFEERKLYFEKPYPFVGNMAAAALQKSSFQRQLTEFYERTRQHKLVGFFNMRTPMITLNDPELIKKVCVKDFDHFPNHQPFITSNDRLFNDMLSVMRDQRWKHMRNTLTPVFTAAKMRNMFTLMNESFAECLQHLDSSSKTLPGRKGFEVDMKVMCNKLSNDIIATTAFGLKVNSYDNPKNEFYEIGQSLVFSRGLQFFKFMLSTLVPKLFSLLKLTIFDSAKVDYFARLVVEAMQYREKHNITRPDMIQLLMEAKNESEDKWTDDEIVAQCFIFFFAAFENNSNLICTTTYELLYNPDVQERLYEEIVETKKALNGAPLTYDAVQKMTYMDMVISESLRKWTLAAATDRLCSKDYTLTDDDGTKLFDFKVGDRINIPISGLHLDDRYFPEPRKFDPDRFSEERKGDMVPYTYLPFGVGPRNCIGNRYALMQVKGMLFNLLLHYKIEASPRTIKDLWGSASGFNFTPRSGFWMHLVPRK
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of CP9B2_DROME !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of CP9B2_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of CP9B2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of CP9B2_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of CP9B2_DROME !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of CP9B2_DROME

loading...

Related Literatures of Post-Translational Modification

TOP