UniProt ID | MAGAA_HUMAN | |
---|---|---|
UniProt AC | P43363 | |
Protein Name | Melanoma-associated antigen 10 | |
Gene Name | MAGEA10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 369 | |
Subcellular Localization | Nucleus . | |
Protein Description | Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.. | |
Protein Sequence | MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIRNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIVFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
56 | Phosphorylation | PSSFPSSSSSSSSSC CCCCCCCCCCCCCCC | 38.28 | - | |
57 | Phosphorylation | SSFPSSSSSSSSSCY CCCCCCCCCCCCCCE | 35.87 | - | |
58 | Phosphorylation | SFPSSSSSSSSSCYP CCCCCCCCCCCCCEE | 35.87 | - | |
59 | Phosphorylation | FPSSSSSSSSSCYPL CCCCCCCCCCCCEEC | 35.87 | - | |
116 | Phosphorylation | SSSQKEESPSTLQVL CCCCCCCCCCCEEEC | 25.83 | 20815410 | |
118 | Phosphorylation | SQKEESPSTLQVLPD CCCCCCCCCEEECCC | 51.53 | 25002506 | |
119 | Phosphorylation | QKEESPSTLQVLPDS CCCCCCCCEEECCCC | 25.29 | 20815410 | |
126 | Phosphorylation | TLQVLPDSESLPRSE CEEECCCCCCCCHHH | 27.43 | 26699800 | |
128 | Phosphorylation | QVLPDSESLPRSEID EECCCCCCCCHHHHH | 47.85 | 26699800 | |
269 | Ubiquitination | LIYGEPRKLLTQDWV HHHCCCCHHCCHHHH | 59.57 | 21906983 | |
280 | Phosphorylation | QDWVQENYLEYRQVP HHHHHHCCCHHCCCC | 10.52 | - | |
283 | Phosphorylation | VQENYLEYRQVPGSD HHHCCCHHCCCCCCC | 12.07 | - | |
310 | Phosphorylation | HAEIRKMSLLKFLAK HHHHHHHHHHHHHHH | 33.32 | 24719451 | |
313 | Ubiquitination | IRKMSLLKFLAKVNG HHHHHHHHHHHHHCC | 43.56 | - | |
317 | Ubiquitination | SLLKFLAKVNGSDPR HHHHHHHHHCCCCCC | 38.08 | - | |
325 | Phosphorylation | VNGSDPRSFPLWYEE HCCCCCCCCCCHHHH | 36.28 | 29523821 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MAGAA_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MAGAA_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MAGAA_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...