UniProt ID | KRE2_YEAST | |
---|---|---|
UniProt AC | P27809 | |
Protein Name | Glycolipid 2-alpha-mannosyltransferase | |
Gene Name | KRE2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 442 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein. |
|
Protein Description | Mannosyltransferase that transfers an alpha-D-mannosyl residue from GDP-mannose into lipid-linked oligosaccharide, forming an alpha-(1->2)-D-mannosyl-D-mannose linkage. Required for the attachment of the third mannose residue of O-linked saccharides.. | |
Protein Sequence | MALFLSKRLLRFTVIAGAVIVLLLTLNSNSRTQQYIPSSISAAFDFTSGSISPEQQVISEENDAKKLEQSALNSEASEDSEAMDEESKALKAAAEKADAPIDTKTTMDYITPSFANKAGKPKACYVTLVRNKELKGLLSSIKYVENKINKKFPYPWVFLNDEPFTEEFKEAVTKAVSSEVKFGILPKEHWSYPEWINQTKAAEIRADAATKYIYGGSESYRHMCRYQSGFFWRHELLEEYDWYWRVEPDIKLYCDINYDVFKWMQENEKVYGFTVSIHEYEVTIPTLWQTSMDFIKKNPEYLDENNLMSFLSNDNGKTYNLCHFWSNFEIANLNLWRSPAYREYFDTLDHQGGFFYERWGDAPVHSIAAALFLPKDKIHYFSDIGYHHPPYDNCPLDKEVYNSNNCECDQGNDFTFQGYSCGKEYYDAQGLVKPKNWKKFRE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Acetylation | -MALFLSKRLLRFTV -CCHHHCHHHHHHHH | 49.57 | 25381059 | |
66 | Ubiquitination | SEENDAKKLEQSALN CCHHHHHHHHHHHHH | 60.00 | 23749301 | |
88 | Acetylation | EAMDEESKALKAAAE HHCHHHHHHHHHHHH | 62.10 | 24489116 | |
96 | Ubiquitination | ALKAAAEKADAPIDT HHHHHHHHCCCCCCC | 47.00 | 23749301 | |
135 | Acetylation | LVRNKELKGLLSSIK EECCHHHHHHHHHHH | 48.91 | 24489116 | |
142 | Acetylation | KGLLSSIKYVENKIN HHHHHHHHHHHHHCC | 45.23 | 24489116 | |
150 | Ubiquitination | YVENKINKKFPYPWV HHHHHCCCCCCCCEE | 60.30 | 17644757 | |
151 | Ubiquitination | VENKINKKFPYPWVF HHHHCCCCCCCCEEE | 47.27 | 17644757 | |
169 | Ubiquitination | EPFTEEFKEAVTKAV CCCCHHHHHHHHHHH | 48.30 | 17644757 | |
174 | Ubiquitination | EFKEAVTKAVSSEVK HHHHHHHHHHCCCCC | 39.94 | 17644757 | |
197 | N-linked_Glycosylation | WSYPEWINQTKAAEI CCCHHHHHHCHHHHH | 44.54 | 1550992 | |
211 | Ubiquitination | IRADAATKYIYGGSE HCHHCCCCEECCCCH | 25.56 | 23749301 | |
211 | Acetylation | IRADAATKYIYGGSE HCHHCCCCEECCCCH | 25.56 | 24489116 | |
251 | Ubiquitination | WRVEPDIKLYCDINY EECCCCEEEEEEECC | 40.56 | 17644757 | |
262 | Ubiquitination | DINYDVFKWMQENEK EECCCHHHHHHHCCC | 41.42 | 17644757 | |
297 | Acetylation | TSMDFIKKNPEYLDE HHHHHHHHCHHHCCC | 73.29 | 24489116 | |
433 | Acetylation | YDAQGLVKPKNWKKF ECCCCCCCCCCHHHH | 56.15 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KRE2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KRE2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KRE2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"Glycosylation in Saccharomyces cerevisiae: cloning andcharacterization of an alpha-1,2-mannosyltransferase structuralgene."; Haeusler A., Robbins P.W.; Glycobiology 2:77-84(1992). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PARTIAL PROTEIN SEQUENCE, ANDGLYCOSYLATION AT ASN-197. |