UniProt ID | CAH8_HUMAN | |
---|---|---|
UniProt AC | P35219 | |
Protein Name | Carbonic anhydrase-related protein | |
Gene Name | CA8 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 290 | |
Subcellular Localization | ||
Protein Description | Does not have a carbonic anhydrase catalytic activity.. | |
Protein Sequence | MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MADLSFIEDTVA ---CCCCCCCCCCCC | 25.40 | 29507054 | |
10 | Phosphorylation | DLSFIEDTVAFPEKE CCCCCCCCCCCCCCC | 10.84 | 26074081 | |
48 | Phosphorylation | FPDANGEYQSPINLN CCCCCCCEECCCCCC | 18.71 | - | |
71 | Phosphorylation | SLLDVRLSPNYVVCR CCCCEEECCCEEEEE | 10.67 | 23186163 | |
94 | Ubiquitination | HTIQVILKSKSVLSG CEEEEEEECCCCCCC | 44.72 | 22817900 | |
96 | Ubiquitination | IQVILKSKSVLSGGP EEEEEECCCCCCCCC | 42.89 | 21890473 | |
196 | Ubiquitination | IQYKGKSKTIPCFNP HHHCCCCCCCCCCCC | 54.69 | - | |
200 | Glutathionylation | GKSKTIPCFNPNTLL CCCCCCCCCCCCCCC | 4.56 | 22555962 | |
258 | Ubiquitination | RRLRTHVKGAELVEG HHHHHHCCHHHHCCC | 44.81 | - | |
266 | Glutathionylation | GAELVEGCDGILGDN HHHHCCCCCCCCCCC | 2.47 | 22555962 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAH8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAH8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAH8_HUMAN !! |
loading...