| UniProt ID | YD366_YEAST | |
|---|---|---|
| UniProt AC | P87287 | |
| Protein Name | Uncharacterized protein YDR366C | |
| Gene Name | YDR366C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 132 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MVTIGSSSLVLFLFFVVFVQITYTALHRFSRLLCTFFSKIIEEGCVWYNKKHRFPNLYKYIYVYVYILHICFEKYVNVEIIVGIPLLIKAIILGIQNILEVLLKDLGIHKRESAILHNSINIIIIILYVYIH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YD366_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD366_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD366_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD366_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RPB1_YEAST | RPO21 | genetic | 27708008 | |
| TCPD_YEAST | CCT4 | genetic | 27708008 | |
| GLE1_YEAST | GLE1 | genetic | 27708008 | |
| COG3_YEAST | COG3 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| MED6_YEAST | MED6 | genetic | 27708008 | |
| ATC7_YEAST | NEO1 | genetic | 27708008 | |
| GWT1_YEAST | GWT1 | genetic | 27708008 | |
| YKT6_YEAST | YKT6 | genetic | 27708008 | |
| BOS1_YEAST | BOS1 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| SMC6_YEAST | SMC6 | genetic | 27708008 | |
| CAP_YEAST | SRV2 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 | |
| MED4_YEAST | MED4 | genetic | 27708008 | |
| SYA_YEAST | ALA1 | genetic | 27708008 | |
| SHE1_YEAST | SHE1 | genetic | 27708008 | |
| AST1_YEAST | AST1 | genetic | 27708008 | |
| YBR3_YEAST | YBR063C | genetic | 27708008 | |
| MCFS2_YEAST | EHT1 | genetic | 27708008 | |
| MTU1_YEAST | SLM3 | genetic | 27708008 | |
| RM01_YEAST | MRPL1 | genetic | 27708008 | |
| GIC1_YEAST | GIC1 | genetic | 27708008 | |
| MRT4_YEAST | MRT4 | genetic | 27708008 | |
| RL37A_YEAST | RPL37A | genetic | 27708008 | |
| CUZ1_YEAST | CUZ1 | genetic | 27708008 | |
| CY1_YEAST | CYT1 | genetic | 27708008 | |
| NIP80_YEAST | NIP100 | genetic | 27708008 | |
| YME1_YEAST | YME1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...