UniProt ID | YD366_YEAST | |
---|---|---|
UniProt AC | P87287 | |
Protein Name | Uncharacterized protein YDR366C | |
Gene Name | YDR366C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 132 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MVTIGSSSLVLFLFFVVFVQITYTALHRFSRLLCTFFSKIIEEGCVWYNKKHRFPNLYKYIYVYVYILHICFEKYVNVEIIVGIPLLIKAIILGIQNILEVLLKDLGIHKRESAILHNSINIIIIILYVYIH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YD366_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD366_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD366_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD366_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPB1_YEAST | RPO21 | genetic | 27708008 | |
TCPD_YEAST | CCT4 | genetic | 27708008 | |
GLE1_YEAST | GLE1 | genetic | 27708008 | |
COG3_YEAST | COG3 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
ATC7_YEAST | NEO1 | genetic | 27708008 | |
GWT1_YEAST | GWT1 | genetic | 27708008 | |
YKT6_YEAST | YKT6 | genetic | 27708008 | |
BOS1_YEAST | BOS1 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
SMC6_YEAST | SMC6 | genetic | 27708008 | |
CAP_YEAST | SRV2 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
MED4_YEAST | MED4 | genetic | 27708008 | |
SYA_YEAST | ALA1 | genetic | 27708008 | |
SHE1_YEAST | SHE1 | genetic | 27708008 | |
AST1_YEAST | AST1 | genetic | 27708008 | |
YBR3_YEAST | YBR063C | genetic | 27708008 | |
MCFS2_YEAST | EHT1 | genetic | 27708008 | |
MTU1_YEAST | SLM3 | genetic | 27708008 | |
RM01_YEAST | MRPL1 | genetic | 27708008 | |
GIC1_YEAST | GIC1 | genetic | 27708008 | |
MRT4_YEAST | MRT4 | genetic | 27708008 | |
RL37A_YEAST | RPL37A | genetic | 27708008 | |
CUZ1_YEAST | CUZ1 | genetic | 27708008 | |
CY1_YEAST | CYT1 | genetic | 27708008 | |
NIP80_YEAST | NIP100 | genetic | 27708008 | |
YME1_YEAST | YME1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...