UniProt ID | WDFY2_HUMAN | |
---|---|---|
UniProt AC | Q96P53 | |
Protein Name | WD repeat and FYVE domain-containing protein 2 | |
Gene Name | WDFY2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 400 | |
Subcellular Localization | Endosome . Early endosome . Cytoplasm . Localizes to intracellular vesicles (PubMed:16792529). Colocalizes with VAMP2 and PRKCZ in intracellular vesicles (PubMed:17313651). Colocalizes with AKT2 in early endosomes (By similarity). | |
Protein Description | Acts in an adapter protein-like fashion to mediate the interaction between the kinase PRKCZ and its substrate VAMP2 and increases the PRKCZ-dependent phosphorylation of VAMP2. [PubMed: 17313651 Positively regulates adipocyte differentiation, by facilitating the phosphorylation and thus inactivation of the anti-adipogenetic transcription factor FOXO1 by the kinase AKT1] | |
Protein Sequence | MAAEIQPKPLTRKPILLQRMEGSQEVVNMAVIVPKEEGVISVSEDRTVRVWLKRDSGQYWPSVYHAMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMTPVKNYQAHQSRVTMILFVLELEWVLSTGQDKQFAWHCSESGQRLGGYRTSAVASGLQFDVETRHVFIGDHSGQVTILKLEQENCTLVTTFRGHTGGVTALCWDPVQRVLFSGSSDHSVIMWDIGGRKGTAIELQGHNDRVQALSYAQHTRQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHEAITDEERAPTATFHDSKHNIVHVHFDATRGWLLTSGTDKVIKLWDMTPVVS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
84 | Phosphorylation | NPETRRLSIGLDNGT CCCCCEEEEECCCCC | 16.88 | 27251275 | |
232 | Ubiquitination | MWDIGGRKGTAIELQ EEECCCCEEEEEEEE | 64.98 | - | |
330 | Phosphorylation | GKCSSKRSSIPLMGF CCCCCCCCCCCCCCE | 36.03 | 27251275 | |
331 | Phosphorylation | KCSSKRSSIPLMGFE CCCCCCCCCCCCCEE | 32.05 | 27251275 | |
383 | Phosphorylation | ATRGWLLTSGTDKVI CCCCEEECCCCCCEE | 23.96 | - | |
386 | Phosphorylation | GWLLTSGTDKVIKLW CEEECCCCCCEEEEE | 32.20 | - | |
388 | Ubiquitination | LLTSGTDKVIKLWDM EECCCCCCEEEEEEC | 45.77 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDFY2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDFY2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDFY2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...