UniProt ID | FIBP_HUMAN | |
---|---|---|
UniProt AC | O43427 | |
Protein Name | Acidic fibroblast growth factor intracellular-binding protein | |
Gene Name | FIBP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 364 | |
Subcellular Localization |
Nucleus. Endomembrane system Peripheral membrane protein. Also associated with cytoplasmic membranes, particularly of mitochondria. |
|
Protein Description | May be involved in mitogenic function of FGF1. May mediate with IER2 FGF-signaling in the establishment of laterality in the embryo (By similarity).. | |
Protein Sequence | MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVGEAPTDPDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTSELDIFV ------CCCCCEEEE | 30.79 | 19369195 | |
2 | Acetylation | ------MTSELDIFV ------CCCCCEEEE | 30.79 | 19369195 | |
75 | Ubiquitination | RLLHAPPKLLHQLIF HHHCCCHHHHHHHHH | 63.72 | - | |
118 | Ubiquitination | KLSKGTKKDLDDIST HCCCCCCCCHHHCHH | 64.46 | - | |
124 | Phosphorylation | KKDLDDISTKTGITL CCCHHHCHHHCCCCH | 30.74 | 26074081 | |
125 | Phosphorylation | KDLDDISTKTGITLK CCHHHCHHHCCCCHH | 32.72 | 26074081 | |
126 | Ubiquitination | DLDDISTKTGITLKS CHHHCHHHCCCCHHH | 37.65 | 21906983 | |
126 (in isoform 1) | Ubiquitination | - | 37.65 | 21890473 | |
126 (in isoform 2) | Ubiquitination | - | 37.65 | 21890473 | |
127 | Phosphorylation | LDDISTKTGITLKSC HHHCHHHCCCCHHHH | 33.63 | 26074081 | |
130 | Phosphorylation | ISTKTGITLKSCRRQ CHHHCCCCHHHHHHH | 29.49 | 26074081 | |
132 | Ubiquitination | TKTGITLKSCRRQFD HHCCCCHHHHHHHHH | 38.57 | 29967540 | |
142 | Acetylation | RRQFDNFKRVFKVVE HHHHHHHHHHHHHHH | 54.64 | 25953088 | |
142 | Ubiquitination | RRQFDNFKRVFKVVE HHHHHHHHHHHHHHH | 54.64 | 24816145 | |
146 | Ubiquitination | DNFKRVFKVVEEMRG HHHHHHHHHHHHHHC | 42.38 | 24816145 | |
146 | Acetylation | DNFKRVFKVVEEMRG HHHHHHHHHHHHHHC | 42.38 | 25953088 | |
235 | Ubiquitination | DMDMDLDKEFLQDLK CCCCCCCHHHHHHHH | 58.63 | 22817900 | |
238 | Ubiquitination | MDLDKEFLQDLKELK CCCCHHHHHHHHHHC | 3.98 | 21890473 | |
238 (in isoform 2) | Ubiquitination | - | 3.98 | 21890473 | |
242 | Ubiquitination | KEFLQDLKELKVLVA HHHHHHHHHHCCEEE | 70.10 | 22817900 | |
244 | Ubiquitination | FLQDLKELKVLVADK HHHHHHHHCCEEECH | 4.43 | 21890473 | |
244 (in isoform 2) | Ubiquitination | - | 4.43 | 21890473 | |
245 (in isoform 1) | Ubiquitination | - | 34.32 | 21890473 | |
245 | Ubiquitination | LQDLKELKVLVADKD HHHHHHHCCEEECHH | 34.32 | 23000965 | |
251 (in isoform 1) | Ubiquitination | - | 40.30 | 21890473 | |
251 | Acetylation | LKVLVADKDLLDLHK HCCEEECHHHHHHHH | 40.30 | 25953088 | |
251 | Ubiquitination | LKVLVADKDLLDLHK HCCEEECHHHHHHHH | 40.30 | 23000965 | |
258 | Ubiquitination | KDLLDLHKSLVCTAL HHHHHHHHHHHHHHH | 53.43 | 23000965 | |
261 | Ubiquitination | LDLHKSLVCTALRGK HHHHHHHHHHHHHHC | 3.35 | 23000965 | |
268 | Ubiquitination | VCTALRGKLGVFSEM HHHHHHHCCCCCCHH | 35.32 | 23000965 | |
273 | Ubiquitination | RGKLGVFSEMEANFK HHCCCCCCHHHHHHC | 33.36 | 21963094 | |
273 (in isoform 2) | Ubiquitination | - | 33.36 | 21890473 | |
280 (in isoform 1) | Ubiquitination | - | 57.71 | 21890473 | |
280 | Ubiquitination | SEMEANFKNLSRGLV CHHHHHHCHHHHHHH | 57.71 | 21963094 | |
285 | Ubiquitination | NFKNLSRGLVNVAAK HHCHHHHHHHHHHHH | 30.51 | 29967540 | |
290 | Ubiquitination | SRGLVNVAAKLTHNK HHHHHHHHHHHHCCC | 8.15 | 29967540 | |
292 | Ubiquitination | GLVNVAAKLTHNKDV HHHHHHHHHHCCCCH | 44.15 | 29967540 | |
297 | Ubiquitination | AAKLTHNKDVRDLFV HHHHHCCCCHHHHHH | 50.42 | 29967540 | |
331 | Phosphorylation | VRFFLNQYSASVHSL HHHHHHHHCCCHHCC | 12.72 | 27732954 | |
332 | Phosphorylation | RFFLNQYSASVHSLD HHHHHHHCCCHHCCC | 12.33 | 27732954 | |
334 | Phosphorylation | FLNQYSASVHSLDGF HHHHHCCCHHCCCCC | 17.89 | 27732954 | |
337 | Phosphorylation | QYSASVHSLDGFRHQ HHCCCHHCCCCCHHH | 26.46 | 27732954 | |
353 | Phosphorylation | LWDRYMGTLRGCLLR HHHHHHHHHHHHHHH | 9.21 | 28060719 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FIBP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FIBP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FIBP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
C2CD5_HUMAN | C2CD5 | physical | 17353931 | |
OGT1_HUMAN | OGT | physical | 17353931 | |
IF6_HUMAN | EIF6 | physical | 17353931 | |
GEMI4_HUMAN | GEMIN4 | physical | 17353931 | |
AP4B1_HUMAN | AP4B1 | physical | 17353931 | |
CLC2L_HUMAN | CLEC2L | physical | 17353931 | |
MIF_HUMAN | MIF | physical | 17353931 | |
A4_HUMAN | APP | physical | 21832049 | |
C2CD5_HUMAN | C2CD5 | physical | 26186194 | |
TMM94_HUMAN | KIAA0195 | physical | 26186194 | |
CABL2_HUMAN | CABLES2 | physical | 26186194 | |
CABL1_HUMAN | CABLES1 | physical | 26186194 | |
CDK5_HUMAN | CDK5 | physical | 26186194 | |
GRM1C_HUMAN | GRAMD1C | physical | 26186194 | |
CDK5_HUMAN | CDK5 | physical | 28514442 | |
C2CD5_HUMAN | C2CD5 | physical | 28514442 | |
CABL2_HUMAN | CABLES2 | physical | 28514442 | |
CABL1_HUMAN | CABLES1 | physical | 28514442 | |
TMM94_HUMAN | KIAA0195 | physical | 28514442 | |
GRM1C_HUMAN | GRAMD1C | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2, AND MASSSPECTROMETRY. |