UniProt ID | USB1_HUMAN | |
---|---|---|
UniProt AC | Q9BQ65 | |
Protein Name | U6 snRNA phosphodiesterase {ECO:0000255|HAMAP-Rule:MF_03040} | |
Gene Name | USB1 {ECO:0000255|HAMAP-Rule:MF_03040} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 265 | |
Subcellular Localization | Nucleus . | |
Protein Description | Phosphodiesterase responsible for the U6 snRNA 3' end processing. Acts as an exoribonuclease (RNase) responsible for trimming the poly(U) tract of the last nucleotides in the pre-U6 snRNA molecule, leading to the formation of mature U6 snRNA 3' end-terminated with a 2',3'-cyclic phosphate.. | |
Protein Sequence | MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSAAPLVGY ------CCCCCCCCC | 24043423 | ||
9 | Phosphorylation | SAAPLVGYSSSGSED CCCCCCCCCCCCCCC | 24043423 | ||
10 | Phosphorylation | AAPLVGYSSSGSEDE CCCCCCCCCCCCCCC | 24043423 | ||
11 | Phosphorylation | APLVGYSSSGSEDES CCCCCCCCCCCCCCC | 24043423 | ||
12 | Phosphorylation | PLVGYSSSGSEDESE CCCCCCCCCCCCCCC | 24043423 | ||
14 | Phosphorylation | VGYSSSGSEDESEDG CCCCCCCCCCCCCCC | 24043423 | ||
18 | Phosphorylation | SSGSEDESEDGMRTR CCCCCCCCCCCCCCC | 30243723 | ||
33 | Methylation | PGDGSHRRGQSPLPR CCCCCCCCCCCCCCC | 115919577 | ||
36 | Phosphorylation | GSHRRGQSPLPRQRF CCCCCCCCCCCCCCC | 30266825 | ||
169 | Phosphorylation | TNQEKTRTFIGLEVT CCCCCEEEEEEEEEE | 24732914 | ||
176 | Phosphorylation | TFIGLEVTSGHAQFL EEEEEEEECCCHHHH | 24732914 | ||
177 | Phosphorylation | FIGLEVTSGHAQFLD EEEEEEECCCHHHHH | 24732914 | ||
187 | Phosphorylation | AQFLDLVSEVDRVME HHHHHHHHHHHHHHH | 24732914 | ||
240 | Acetylation | IVDGFEDAEVLLRVH HHCCCCCHHHHHHEE | 19608861 | ||
258 | Acetylation | VRCKSGNKFFSMPLK EEECCCCEEECCCCC | 19608861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of USB1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of USB1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of USB1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
604173 | Poikiloderma with neutropenia (PN) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...