| UniProt ID | USB1_HUMAN | |
|---|---|---|
| UniProt AC | Q9BQ65 | |
| Protein Name | U6 snRNA phosphodiesterase {ECO:0000255|HAMAP-Rule:MF_03040} | |
| Gene Name | USB1 {ECO:0000255|HAMAP-Rule:MF_03040} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 265 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Phosphodiesterase responsible for the U6 snRNA 3' end processing. Acts as an exoribonuclease (RNase) responsible for trimming the poly(U) tract of the last nucleotides in the pre-U6 snRNA molecule, leading to the formation of mature U6 snRNA 3' end-terminated with a 2',3'-cyclic phosphate.. | |
| Protein Sequence | MSAAPLVGYSSSGSEDESEDGMRTRPGDGSHRRGQSPLPRQRFPVPDSVLNMFPGTEEGPEDDSTKHGGRVRTFPHERGNWATHVYVPYEAKEEFLDLLDVLLPHAQTYVPRLVRMKVFHLSLSQSVVLRHHWILPFVQALKARMTSFHRFFFTANQVKIYTNQEKTRTFIGLEVTSGHAQFLDLVSEVDRVMEEFNLTTFYQDPSFHLSLAWCVGDARLQLEGQCLQELQAIVDGFEDAEVLLRVHTEQVRCKSGNKFFSMPLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSAAPLVGY ------CCCCCCCCC | 24043423 | ||
| 9 | Phosphorylation | SAAPLVGYSSSGSED CCCCCCCCCCCCCCC | 24043423 | ||
| 10 | Phosphorylation | AAPLVGYSSSGSEDE CCCCCCCCCCCCCCC | 24043423 | ||
| 11 | Phosphorylation | APLVGYSSSGSEDES CCCCCCCCCCCCCCC | 24043423 | ||
| 12 | Phosphorylation | PLVGYSSSGSEDESE CCCCCCCCCCCCCCC | 24043423 | ||
| 14 | Phosphorylation | VGYSSSGSEDESEDG CCCCCCCCCCCCCCC | 24043423 | ||
| 18 | Phosphorylation | SSGSEDESEDGMRTR CCCCCCCCCCCCCCC | 30243723 | ||
| 33 | Methylation | PGDGSHRRGQSPLPR CCCCCCCCCCCCCCC | 115919577 | ||
| 36 | Phosphorylation | GSHRRGQSPLPRQRF CCCCCCCCCCCCCCC | 30266825 | ||
| 169 | Phosphorylation | TNQEKTRTFIGLEVT CCCCCEEEEEEEEEE | 24732914 | ||
| 176 | Phosphorylation | TFIGLEVTSGHAQFL EEEEEEEECCCHHHH | 24732914 | ||
| 177 | Phosphorylation | FIGLEVTSGHAQFLD EEEEEEECCCHHHHH | 24732914 | ||
| 187 | Phosphorylation | AQFLDLVSEVDRVME HHHHHHHHHHHHHHH | 24732914 | ||
| 240 | Acetylation | IVDGFEDAEVLLRVH HHCCCCCHHHHHHEE | 19608861 | ||
| 258 | Acetylation | VRCKSGNKFFSMPLK EEECCCCEEECCCCC | 19608861 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of USB1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of USB1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of USB1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 604173 | Poikiloderma with neutropenia (PN) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...