UniProt ID | TOM5_HUMAN | |
---|---|---|
UniProt AC | Q8N4H5 | |
Protein Name | Mitochondrial import receptor subunit TOM5 homolog | |
Gene Name | TOMM5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 51 | |
Subcellular Localization |
Mitochondrion outer membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MFRIEGLA -------CCCCCCCC | 4.61 | 25944712 | |
10 | Ubiquitination | RIEGLAPKLDPEEMK CCCCCCCCCCHHHHH | 60.97 | 23000965 | |
10 | Ubiquitination | RIEGLAPKLDPEEMK CCCCCCCCCCHHHHH | 60.97 | 21890473 | |
10 | Acetylation | RIEGLAPKLDPEEMK CCCCCCCCCCHHHHH | 60.97 | 26051181 | |
10 | Sumoylation | RIEGLAPKLDPEEMK CCCCCCCCCCHHHHH | 60.97 | 28112733 | |
17 | Ubiquitination | KLDPEEMKRKMREDV CCCHHHHHHHHHHHH | 52.74 | 33845483 | |
17 | 2-Hydroxyisobutyrylation | KLDPEEMKRKMREDV CCCHHHHHHHHHHHH | 52.74 | - | |
17 | Acetylation | KLDPEEMKRKMREDV CCCHHHHHHHHHHHH | 52.74 | 26051181 | |
26 | Phosphorylation | KMREDVISSIRNFLI HHHHHHHHHHHHHHH | 21.40 | 20068231 | |
27 | Phosphorylation | MREDVISSIRNFLIY HHHHHHHHHHHHHHH | 17.91 | 20068231 | |
46 | Acetylation | RVTPFILKKLDSI-- HHHHHHHHHHHCC-- | 46.61 | 19608861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TOM5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TOM5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TOM5_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-46, AND MASS SPECTROMETRY. |