UniProt ID | SYB_DROME | |
---|---|---|
UniProt AC | P18489 | |
Protein Name | Synaptobrevin | |
Gene Name | Syb | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 152 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein . Cell junction, synapse, synaptosome . Cell membrane Single-pass type IV membrane protein . Neuronal synaptic vesicles (By similarity). In emb |
|
Protein Description | Unknown, but synaptobrevins are presumed to be involved in targeting and fusion of synaptic vesicles with the presynaptic membrane as well as in neurotransmitter release.. | |
Protein Sequence | MENNEAPSPSGSNNNDFPILPPPPNANDNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPSSSDSGSGGGNKAITQAPPH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MENNEAPSPSGSNNN CCCCCCCCCCCCCCC | 38.45 | 19429919 | |
8 (in isoform 3) | Phosphorylation | - | 38.45 | 19429919 | |
8 (in isoform 4) | Phosphorylation | - | 38.45 | 19429919 | |
10 | Phosphorylation | NNEAPSPSGSNNNDF CCCCCCCCCCCCCCC | 60.22 | 19429919 | |
10 (in isoform 3) | Phosphorylation | - | 60.22 | 19429919 | |
10 (in isoform 4) | Phosphorylation | - | 60.22 | 19429919 | |
12 | Phosphorylation | EAPSPSGSNNNDFPI CCCCCCCCCCCCCCC | 40.50 | 19429919 | |
12 (in isoform 3) | Phosphorylation | - | 40.50 | 19429919 | |
12 (in isoform 4) | Phosphorylation | - | 40.50 | 19429919 | |
77 | Phosphorylation | LERDQKLSELGERAD HHHHHHHHHHHHHHH | 37.50 | 19429919 | |
91 | Phosphorylation | DQLEQGASQFEQQAG HHHHHHHHHHHHHHH | 42.08 | 19429919 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYB_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYB_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYB_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PICAL_DROME | lap | physical | 15710747 | |
STX1A_DROME | Syx1A | physical | 15710747 | |
GSTD1_DROME | GstD1 | physical | 15710747 | |
PP2B2_DROME | Pp2B-14D | physical | 15710747 | |
TNNC2_DROME | TpnC47D | physical | 15710747 | |
STX1A_DROME | Syx1A | physical | 22036573 | |
SNP25_DROME | Snap25 | physical | 22036573 | |
SLY1_DROME | Slh | physical | 22036573 | |
SNAP_DROME | alphaSnap | physical | 22036573 | |
FAXC_DROME | fax | physical | 22036573 | |
STX5_DROME | Syx5 | physical | 22036573 | |
GOSR2_DROME | Membrin | physical | 22036573 | |
Y2138_DROME | CG32138 | physical | 22036573 | |
GOSR1_DROME | Gos28 | physical | 22036573 | |
USE1_DROME | Use1 | physical | 22036573 | |
SPY_DROME | sty | physical | 22036573 | |
VDAC_DROME | porin | physical | 22036573 | |
STX4_DROME | Syx4 | physical | 22036573 | |
FLOT2_DROME | Flo2 | physical | 22036573 | |
DOS_DROME | dos | physical | 22036573 | |
ATP5J_DROME | ATPsyn-Cf6 | physical | 22036573 | |
ELF1_DROME | grh | physical | 25242320 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...