SYB_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SYB_DROME
• UniProt AC: P18489
• Protein Name: Synaptobrevin
• Gene Name: Syb
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 152
• Subcellular Localization: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane ; Single-pass type IV membrane protein . Cell junction, synapse, synaptosome . Cell membrane ; Single-pass type IV membrane protein . Neuronal synaptic vesicles (By similarity). In emb
• Protein Description: Unknown, but synaptobrevins are presumed to be involved in targeting and fusion of synaptic vesicles with the presynaptic membrane as well as in neurotransmitter release..
• Protein Sequence: MENNEAPSPSGSNNNDFPILPPPPNANDNYNQFGDHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPSSSDSGSGGGNKAITQAPPH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MENNEAPSPSGSNNN CCCCCCCCCCCCCCC	38.45	19429919
8 (in isoform 3)	Phosphorylation	-	38.45	19429919
8 (in isoform 4)	Phosphorylation	-	38.45	19429919
10	Phosphorylation	NNEAPSPSGSNNNDF CCCCCCCCCCCCCCC	60.22	19429919
10 (in isoform 3)	Phosphorylation	-	60.22	19429919
10 (in isoform 4)	Phosphorylation	-	60.22	19429919
12	Phosphorylation	EAPSPSGSNNNDFPI CCCCCCCCCCCCCCC	40.50	19429919
12 (in isoform 3)	Phosphorylation	-	40.50	19429919
12 (in isoform 4)	Phosphorylation	-	40.50	19429919
77	Phosphorylation	LERDQKLSELGERAD HHHHHHHHHHHHHHH	37.50	19429919
91	Phosphorylation	DQLEQGASQFEQQAG HHHHHHHHHHHHHHH	42.08	19429919

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SYB_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SYB_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SYB_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PICAL_DROME	lap	physical	15710747
STX1A_DROME	Syx1A	physical	15710747
GSTD1_DROME	GstD1	physical	15710747
PP2B2_DROME	Pp2B-14D	physical	15710747
TNNC2_DROME	TpnC47D	physical	15710747
STX1A_DROME	Syx1A	physical	22036573
SNP25_DROME	Snap25	physical	22036573
SLY1_DROME	Slh	physical	22036573
SNAP_DROME	alphaSnap	physical	22036573
FAXC_DROME	fax	physical	22036573
STX5_DROME	Syx5	physical	22036573
GOSR2_DROME	Membrin	physical	22036573
Y2138_DROME	CG32138	physical	22036573
GOSR1_DROME	Gos28	physical	22036573
USE1_DROME	Use1	physical	22036573
SPY_DROME	sty	physical	22036573
VDAC_DROME	porin	physical	22036573
STX4_DROME	Syx4	physical	22036573
FLOT2_DROME	Flo2	physical	22036573
DOS_DROME	dos	physical	22036573
ATP5J_DROME	ATPsyn-Cf6	physical	22036573
ELF1_DROME	grh	physical	25242320

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.