STX4_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: STX4_DROME
• UniProt AC: Q7KVY7
• Protein Name: Syntaxin-4
• Gene Name: Syx4 {ECO:0000312|EMBL:AAF45823.2}
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 333
• Subcellular Localization: Membrane ; Single-pass type IV membrane protein .
• Protein Description: Potentially involved in docking of synaptic vesicles at presynaptic active zones..
• Protein Sequence: MGKDRLPELLQRSLSTNSSNSSSNGSLLLNVYSGTTEFIIGNTGGNNNSYSVVSQNSHSCSNNNSSTEPKDRSSSKMTQYGSNVDDILNPYTEIRQQLAQIAANLETMNRMAQTVNLRTFNENEMDELHNKNLRLGNQLMTRFNDFKANLPAENDYSLEARMKRTLFYGLHQTFINLWHKNELFLQNYETKVKKNLRLHTKIINSEASEQEIELLIENKTTKLFVDNFLQETEKERQTLREMMDRFNELRRLEKSIEEVHALFMRIQTLVMEQSEVIQRVEFHAQQATLHVDKGADELDQAEQHQKKARKKKIMLIVILAAVLLVLLLVGIYL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
188	Phosphorylation	NELFLQNYETKVKKN CHHHHHCHHHHHHHH	16.41	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of STX4_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of STX4_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of STX4_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MTU1_DROME	CG3021	physical	14605208
COPB_DROME	betaCOP	physical	14605208

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.