UniProt ID | STX1A_DROME | |
---|---|---|
UniProt AC | Q24547 | |
Protein Name | Syntaxin-1A | |
Gene Name | Syx1A | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 291 | |
Subcellular Localization |
Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane Single-pass type IV membrane protein . Lysosome membrane Single-pass type IV membrane protein . |
|
Protein Description | Plays a critical role in several secretory processes, including cuticle secretion and neurotransmitter release, and probably assists in neuronal membrane maturation or the final stages of neuronal differentiation. [PubMed: 7834751 Essential for embryonic viability and development] | |
Protein Sequence | MTKDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILICLTVLGILAASYVSSYFM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | AALHAAQSDDEEETE HHHHHHCCCCCCCCC | 42.16 | 23607784 | |
20 | Phosphorylation | QSDDEEETEVAVNVD CCCCCCCCCEEEECC | 38.75 | 23607784 | |
70 | Phosphorylation | AILSAPQTDEKTKQE HHHCCCCCCHHHHHH | 45.10 | 18327897 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STX1A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STX1A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STX1A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SNAP_DROME | alphaSnap | physical | 14605208 | |
SLY1_DROME | Slh | physical | 22036573 | |
SNAP_DROME | alphaSnap | physical | 22036573 | |
USE1_DROME | Use1 | physical | 22036573 | |
GOSR2_DROME | Membrin | physical | 22036573 | |
GOSR1_DROME | Gos28 | physical | 22036573 | |
NSF2_DROME | Nsf2 | physical | 22036573 | |
POK_DROME | aop | genetic | 15687281 | |
GMDS_DROME | Gmd | genetic | 15687281 | |
SMRCD_DROME | Etl1 | genetic | 15687281 | |
ACT2_DROME | Act42A | genetic | 15687281 | |
EFR3_DROME | stmA | genetic | 16510714 | |
PDK_DROME | Pdk | genetic | 15687281 | |
RS23_DROME | RpS23 | genetic | 15687281 | |
CDV3_DROME | CG3760 | genetic | 15687281 | |
DNJC5_DROME | Csp | genetic | 10575024 | |
SEPT1_DROME | Sep1 | physical | 17456438 | |
SY65_DROME | Syt1 | physical | 20688915 | |
SY65_DROME | Syt1 | physical | 21307261 | |
SNP25_DROME | Snap25 | physical | 21316453 | |
SNP25_DROME | Snap25 | physical | 20688915 | |
PNUT_DROME | pnut | physical | 17456438 | |
SNAP_DROME | alphaSnap | physical | 21316453 | |
NSF1_DROME | comt | physical | 21316453 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...