UniProt ID | SY132_ARATH | |
---|---|---|
UniProt AC | Q8VZU2 | |
Protein Name | Syntaxin-132 | |
Gene Name | SYP132 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 304 | |
Subcellular Localization |
Membrane Single-pass type IV membrane protein. |
|
Protein Description | Vesicle trafficking protein that functions in the secretory pathway.. | |
Protein Sequence | MNDLLKGSFELPRGQSSREGDVELGEQQGGDQGLEDFFKKVQVIDKQYDKLDKLLKKLQASHEESKSVTKAPAMKAIKKTMEKDVDEVGSIARFIKGKLEELDRENLANRQKPGCAKGSGVDRSRTATTLSLKKKLKDKMAEFQVLRENIQQEYRDVVDRRVYTVTGERADEDTIDELIETGNSEQIFQKAIQEQGRGQVMDTLAEIQERHDAVRDLEKKLLDLQQIFLDMAVLVDAQGEMLDNIESQVSSAVDHVQSGNTALQRAKSLQKNSRKWMCIAIIILLIVVAVIVVGVLKPWKNKSA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNDLLKGS -------CCCHHCCC | 8.75 | - | |
8 | Phosphorylation | MNDLLKGSFELPRGQ CCCHHCCCCCCCCCC | 17.60 | 17317660 | |
16 | Phosphorylation | FELPRGQSSREGDVE CCCCCCCCCCCCCCC | 33.90 | 19880383 | |
17 | Phosphorylation | ELPRGQSSREGDVEL CCCCCCCCCCCCCCH | 26.85 | 23776212 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SY132_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SY132_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SY132_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteomics of the Arabidopsis plasma membrane and a newphosphorylation site database."; Nuehse T.S., Stensballe A., Jensen O.N., Peck S.C.; Plant Cell 16:2394-2405(2004). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8, AND MASSSPECTROMETRY. | |
"Large-scale analysis of in vivo phosphorylated membrane proteins byimmobilized metal ion affinity chromatography and mass spectrometry."; Nuehse T.S., Stensballe A., Jensen O.N., Peck S.C.; Mol. Cell. Proteomics 2:1234-1243(2003). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-8, AND MASSSPECTROMETRY. |