UniProt ID | RS3A1_ARATH | |
---|---|---|
UniProt AC | Q9CAV0 | |
Protein Name | 40S ribosomal protein S3a-1 {ECO:0000255|HAMAP-Rule:MF_03122} | |
Gene Name | RPS3AA {ECO:0000255|HAMAP-Rule:MF_03122} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 262 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MAVGKNKRISKGRKGGKKKAVDPFSKKDWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVKVDRPADEMAVEEPTEIIGA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | WYDVKAPSIFTHRNV CCCCCCCCEEEECCC | 34.88 | 29654922 | |
69 | Phosphorylation | KHRVFEVSLADLQGD HHCEEEEEHHHHCCC | 15.61 | 19880383 | |
81 | Phosphorylation | QGDEDNAYRKIRLRA CCCCCCCHHHHHHHH | 20.77 | 19880383 | |
177 | Phosphorylation | DIMVREASSCDLKDL HHHHHCCCCCCHHHH | 27.09 | 23776212 | |
178 | Phosphorylation | IMVREASSCDLKDLV HHHHCCCCCCHHHHH | 20.78 | 23776212 | |
235 | Phosphorylation | LMDVHGDYSAEDVGV CCCCCCCCCHHHCCC | 17.86 | 23776212 | |
236 | Phosphorylation | MDVHGDYSAEDVGVK CCCCCCCCHHHCCCE | 29.89 | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RS3A1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RS3A1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RS3A1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of RS3A1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-236, AND MASSSPECTROMETRY. |