UniProt ID | PIP24_ARATH | |
---|---|---|
UniProt AC | Q9FF53 | |
Protein Name | Probable aquaporin PIP2-4 | |
Gene Name | PIP2-4 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 291 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.. | |
Protein Sequence | MAKDLDVNESGPPAARDYKDPPPAPFFDMEELRKWPLYRAVIAEFVATLLFLYVSILTVIGYKAQTDATAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNNEKAWDDQWIFWVGPMIGAAAAAFYHQFILRAAAIKALGSFGSFGSFRSFA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MAKDLDVN -------CCCCCCCC | 10.63 | - | |
2 | Acetylation | ------MAKDLDVNE ------CCCCCCCCC | 17.67 | - | |
3 | Methylation | -----MAKDLDVNES -----CCCCCCCCCC | 58.48 | - | |
280 | Phosphorylation | AAIKALGSFGSFGSF HHHHHHHCCCCCCCC | 27.55 | 30291188 | |
283 | Phosphorylation | KALGSFGSFGSFRSF HHHHCCCCCCCCCCC | 25.15 | 30291188 | |
286 | Phosphorylation | GSFGSFGSFRSFA-- HCCCCCCCCCCCC-- | 18.57 | 30291188 | |
289 | Phosphorylation | GSFGSFRSFA----- CCCCCCCCCC----- | 24.42 | 23111157 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIP24_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIP24_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIP24_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PIP24_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteomic analysis of nuclei-enriched fractions fromArabidopsis thaliana."; Jones A.M.E., MacLean D., Studholme D.J., Serna-Sanz A.,Andreasson E., Rathjen J.P., Peck S.C.; J. Proteomics 72:439-451(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-286, AND MASSSPECTROMETRY. |