dbPTM

VA721_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VA721_ARATH
UniProt AC	Q9ZTW3
Protein Name	Vesicle-associated membrane protein 721 {ECO:0000303\|PubMed:11115874}
Gene Name	VAMP721 {ECO:0000303\|PubMed:11115874}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	219
Subcellular Localization	Cell membrane Single-pass type IV membrane protein . Early endosome membrane Single-pass type IV membrane protein .
Protein Description	Involved in the targeting and/or fusion of transport vesicles to their target membrane..
Protein Sequence	MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVEDGFTYCVVAVDSAGRQIPMSFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTTGTQMRRKMWLQNMKIKLIVLAIIIALILIIVLSVCHGFKC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Phosphorylation	YGGGKAATAQANSLN CCCHHHHHHHHHHHH	24.94	30407730
105	Phosphorylation	AATAQANSLNKEFGS HHHHHHHHHHHHHHH	36.01	30407730
139	Phosphorylation	AKVKAQVSEVKGVMM HHHHHHHHHCCCHHH	25.29	30407730
166	Phosphorylation	IELLVDKTENLRSQA EEEEEECCCHHHHHH	26.16	30291188
171	Phosphorylation	DKTENLRSQAQDFRT ECCCHHHHHHHHHHH	32.79	27288362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VA721_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VA721_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VA721_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
SY111_ARATH	SYP111	physical	23515225
NPS11_ARATH	NPSN11	physical	23515225

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VA721_ARATH

Related Literatures of Post-Translational Modification