dbPTM

NPS11_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	NPS11_ARATH
UniProt AC	Q944A9
Protein Name	Novel plant SNARE 11
Gene Name	NPSN11
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	265
Subcellular Localization	Membrane Single-pass type IV membrane protein. Cell plate during cell division.
Protein Description	t-SNARE involved in diverse vesicle trafficking and membrane fusion processes, including cell plate formation..
Protein Sequence	MDPISAVSEELAEIEGQINDIFRALSNGFQKLEKIKDANRQSRQLEELTDKMRDCKSLIKDFDREIKSLESGNDASTNRMLNDRRQSMVKELNSYVALKKKYSSNLASNNKRVDLFDGPGEEHMEENVLLASNMSNQELMDKGNSMMDDTDQAIERGKKIVQETINVGTDTSAALKAQTEQMSRVVNELDSIHFSLKKASKLVKEIGRQVATDKCIMAFLFLIVIGVIAIIIVKIVNPNNKDIRDIPGVGLAPPAMNRRLLWNHY

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
87	Phosphorylation	MLNDRRQSMVKELNS HHHHHHHHHHHHHHH	24.59	28295753
94	Phosphorylation	SMVKELNSYVALKKK HHHHHHHHHHHHHHH	33.34	28295753
95	Phosphorylation	MVKELNSYVALKKKY HHHHHHHHHHHHHHH	6.67	28295753

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of NPS11_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of NPS11_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of NPS11_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SY111_ARATH	SYP111	physical	12068098
SYP21_ARATH	SYP21	physical	12068098
VTI12_ARATH	VTI1B	physical	12068098
SY111_ARATH	SYP111	physical	23515225
SYP71_ARATH	SYP71	physical	23515225
VA721_ARATH	VAMP721	physical	23515225
VA722_ARATH	SAR1	physical	23515225
UBC34_ARATH	UBC34	physical	24833385
DER22_ARATH	DER2.2	physical	24833385

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of NPS11_ARATH

Related Literatures of Post-Translational Modification