UniProt ID | VA722_ARATH | |
---|---|---|
UniProt AC | P47192 | |
Protein Name | Vesicle-associated membrane protein 722 {ECO:0000303|PubMed:11115874} | |
Gene Name | VAMP722 {ECO:0000303|PubMed:11115874} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 221 | |
Subcellular Localization |
Cell membrane Single-pass type IV membrane protein . Early endosome membrane Single-pass type IV membrane protein . |
|
Protein Description | Involved in the targeting and/or fusion of transport vesicles to their target membrane.. | |
Protein Sequence | MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
100 | Phosphorylation | YGGGKAATAQANSLN CCCHHHHHHHHHHHH | 24.94 | 30407730 | |
105 | Phosphorylation | AATAQANSLNKEFGS HHHHHHHHHHHHHHH | 36.01 | 30407730 | |
139 | Phosphorylation | AKVKAQVSEVKGVMM HHHHHHHHHCCCHHH | 25.29 | 30407730 | |
166 | Phosphorylation | IELLVDKTENLRSQA EEEEEECCCHHHHHH | 26.16 | 30291188 | |
171 | Phosphorylation | DKTENLRSQAQDFRT ECCCHHHHHHHHHHH | 32.79 | 27288362 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VA722_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VA722_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VA722_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NAC89_ARATH | NAC089 | physical | 21798944 | |
RTNLD_ARATH | BTI3 | physical | 21798944 | |
NUP35_ARATH | AT3G16310 | physical | 21798944 | |
NIP11_ARATH | NLM1 | physical | 21798944 | |
VAP11_ARATH | VAP | physical | 21798944 | |
Y4645_ARATH | AT4G26450 | physical | 21798944 | |
MHX_ARATH | MHX | physical | 24833385 | |
DERL1_ARATH | DER1 | physical | 24833385 | |
RBL14_ARATH | RBL14 | physical | 24833385 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...