VA722_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VA722_ARATH
• UniProt AC: P47192
• Protein Name: Vesicle-associated membrane protein 722 {ECO:0000303|PubMed:11115874}
• Gene Name: VAMP722 {ECO:0000303|PubMed:11115874}
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 221
• Subcellular Localization: Cell membrane ; Single-pass type IV membrane protein . Early endosome membrane ; Single-pass type IV membrane protein .
• Protein Description: Involved in the targeting and/or fusion of transport vesicles to their target membrane..
• Protein Sequence: MAQQSLIYSFVARGTVILVEFTDFKGNFTSIAAQCLQKLPSSNNKFTYNCDGHTFNYLVENGFTYCVVAVDSAGRQIPMAFLERVKEDFNKRYGGGKAATAQANSLNKEFGSKLKEHMQYCMDHPDEISKLAKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQMRRKMWFQNMKIKLIVLAIIIALILIIILSICGGFNCGK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
100	Phosphorylation	YGGGKAATAQANSLN CCCHHHHHHHHHHHH	24.94	30407730
105	Phosphorylation	AATAQANSLNKEFGS HHHHHHHHHHHHHHH	36.01	30407730
139	Phosphorylation	AKVKAQVSEVKGVMM HHHHHHHHHCCCHHH	25.29	30407730
166	Phosphorylation	IELLVDKTENLRSQA EEEEEECCCHHHHHH	26.16	30291188
171	Phosphorylation	DKTENLRSQAQDFRT ECCCHHHHHHHHHHH	32.79	27288362

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VA722_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VA722_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VA722_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NAC89_ARATH	NAC089	physical	21798944
RTNLD_ARATH	BTI3	physical	21798944
NUP35_ARATH	AT3G16310	physical	21798944
NIP11_ARATH	NLM1	physical	21798944
VAP11_ARATH	VAP	physical	21798944
Y4645_ARATH	AT4G26450	physical	21798944
MHX_ARATH	MHX	physical	24833385
DERL1_ARATH	DER1	physical	24833385
RBL14_ARATH	RBL14	physical	24833385

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.