UniProt ID | SY111_ARATH | |
---|---|---|
UniProt AC | Q42374 | |
Protein Name | Syntaxin-related protein KNOLLE | |
Gene Name | KN | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 310 | |
Subcellular Localization |
Membrane Single-pass type IV membrane protein. |
|
Protein Description | Involved in cytokinesis. Acts as a cell plate-specific syntaxin, required for the fusion of vesicles at the plane of cell division.. | |
Protein Sequence | MNDLMTKSFMSYVDLKKAAMKDMEAGPDFDLEMASTKADKMDENLSSFLEEAEYVKAEMGLISETLARIEQYHEESKGVHKAESVKSLRNKISNEIVSGLRKAKSIKSKLEEMDKANKEIKRLSGTPVYRSRTAVTNGLRKKLKEVMMEFQGLRQKMMSEYKETVERRYFTVTGEHANDEMIEKIITDNAGGEEFLTRAIQEHGKGKVLETVVEIQDRYDAAKEIEKSLLELHQVFLDMAVMVESQGEQMDEIEHHVINASHYVADGANELKTAKSHQRNSRKWMCIGIIVLLLIILIVVIPIITSFSSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MNDLMTKS -------CCCHHCHH | 8.75 | - | |
11 | Phosphorylation | LMTKSFMSYVDLKKA HHCHHHHHHHHHHHH | 21.72 | 25561503 | |
12 | Phosphorylation | MTKSFMSYVDLKKAA HCHHHHHHHHHHHHH | 6.03 | 25561503 | |
124 | Phosphorylation | NKEIKRLSGTPVYRS HHHHHHHHCCCCCCC | 44.66 | 30291188 | |
126 | Phosphorylation | EIKRLSGTPVYRSRT HHHHHHCCCCCCCHH | 13.25 | 25561503 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SY111_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SY111_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SY111_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NPS11_ARATH | NPSN11 | physical | 12068098 | |
SNP33_ARATH | SNAP33 | physical | 11591731 | |
SNP29_ARATH | SNAP29 | physical | 11591731 | |
SNP30_ARATH | SNAP30 | physical | 11591731 | |
KEULE_ARATH | KEU | physical | 22595672 | |
CDPK1_ARATH | CPK1 | physical | 22737156 | |
NPS11_ARATH | NPSN11 | physical | 23515225 | |
SNP33_ARATH | SNAP33 | physical | 23515225 | |
SYP71_ARATH | SYP71 | physical | 23515225 | |
VA721_ARATH | VAMP721 | physical | 23515225 | |
VA722_ARATH | SAR1 | physical | 23515225 | |
RL171_ARATH | AT1G27400 | physical | 24556609 | |
RL111_ARATH | RPL16A | physical | 24556609 | |
VCS_ARATH | VCS | physical | 24556609 | |
RS241_ARATH | AT3G04920 | physical | 24556609 | |
RL81_ARATH | EMB2296 | physical | 24556609 | |
RL101_ARATH | SAC52 | physical | 24556609 | |
RS91_ARATH | AT5G15200 | physical | 24556609 | |
RL312_ARATH | AT4G26230 | physical | 24556609 | |
RS111_ARATH | EMB1080 | physical | 24556609 | |
RS41_ARATH | AT2G17360 | physical | 24556609 | |
RL31_ARATH | RP1 | physical | 24556609 | |
CAMT4_ARATH | CCoAOMT1 | physical | 24556609 | |
ENPL_ARATH | SHD | physical | 24556609 | |
RS191_ARATH | AT3G02080 | physical | 24556609 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...