| UniProt ID | RL101_ARATH | |
|---|---|---|
| UniProt AC | Q93VT9 | |
| Protein Name | 60S ribosomal protein L10-1 {ECO:0000303|PubMed:11598216} | |
| Gene Name | RPL10A {ECO:0000303|PubMed:11598216} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 220 | |
| Subcellular Localization | Cytoplasm . Nucleus . Phosphorylation by NIK1 relocates the cytosolic protein to the nucleus. | |
| Protein Description | Ribosomal protein involved in translational regulation. [PubMed: 18694459 Contribute to general translation under UV-B stress] | |
| Protein Sequence | MGRRPARCYRQIKGKPYPKSRYCRGVPDPKIRIYDVGMKRKGVDEFPFCVHLVSWEKENVSSEALEAARIACNKYMVKSAGKDAFHLRIRVHPFHVLRINKMLSCAGADRLQTGMRGAFGKALGTCARVAIGQVLLSVRCKDAHGHHAQEALRRAKFKFPGRQKIIVSRKWGFTKFNRADFTKLRQEKRVVPDGVNAKFLSCHGPLANRQPGSAFLPAHY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 38 | Sulfoxidation | IRIYDVGMKRKGVDE EEEEECCCCCCCCCC | 3.69 | 25693801 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RL101_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RL101_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RL101_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...