dbPTM

RS191_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RS191_ARATH
UniProt AC	Q9SGA6
Protein Name	40S ribosomal protein S19-1
Gene Name	RPS19A
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	143
Subcellular Localization
Protein Description
Protein Sequence	MATGKTVKDVSPHDFVKAYASHLKRSGKIELPTWTDIVKTGKLKELAPYDPDWYYIRAASMARKVYLRGGLGVGAFRRIYGGSKRNGSRPPHFCKSSGGIARHILQQLETMNIVELDTKGGRRITSSGQRDLDQVAGRIAVEP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Phosphorylation	GKTVKDVSPHDFVKA CCCCCCCCHHHHHHH	27.01	25561503
19	Phosphorylation	PHDFVKAYASHLKRS HHHHHHHHHHHHHHC	11.70	19880383
21	Phosphorylation	DFVKAYASHLKRSGK HHHHHHHHHHHHCCC	19.37	23820729

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RS191_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RS191_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RS191_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RS191_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RS191_ARATH

Related Literatures of Post-Translational Modification