RS41_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RS41_ARATH
• UniProt AC: Q93VH9
• Protein Name: 40S ribosomal protein S4-1
• Gene Name: RPS4A
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 261
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEENKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDSTGHEFATRLGNVYTIGKGTKPWVSLPKGKGIKLTIIEEARKRLSAQQA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
128	Phosphorylation	FKLCKVRSIQFGQKG EEEEEEEEEECCCCC	24.59	23776212
232	Phosphorylation	VYTIGKGTKPWVSLP EEEECCCCCCEEECC	37.10	25561503
257	Phosphorylation	EEARKRLSAQQA--- HHHHHHHHHHCC---	28.23	29654922

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RS41_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RS41_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RS41_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of RS41_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.