| UniProt ID | DER22_ARATH | |
|---|---|---|
| UniProt AC | Q9ZS88 | |
| Protein Name | Derlin-2.2 | |
| Gene Name | DER2.2 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 244 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
| Protein Description | May be involved in the degradation process of specific misfolded endoplasmic reticulum (ER) luminal proteins.. | |
| Protein Sequence | MAQAVEEWYKQMPIITRSYLTAAVITTVGCSLDIISPYNLYLNPTLVVKQYQYWRLVTNFLYFRKMDLDFMFHMFFLARYCKLLEENSFRGKTADFLYMLLFGASVLTGIVLIGGMIPYLSASFAKIIFLSNSLTFMMVYVWSKQNPYIHMSFLGLFTFTAAYLPWVLLGFSILVGASAWVDLLGMIAGHAYYFLAEVYPRMTNRRPLKTPSFLKALFADEPVVVARPEDVRFAAAPFDEIHQD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of DER22_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DER22_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DER22_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DER22_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HHP4_ARATH | HHP4 | physical | 24833385 | |
| MHX_ARATH | MHX | physical | 24833385 | |
| UBC34_ARATH | UBC34 | physical | 24833385 | |
| FEI1_ARATH | FEI1 | physical | 24833385 | |
| TRXH5_ARATH | TRX5 | physical | 24833385 | |
| CNIH1_ARATH | AT3G12180 | physical | 24833385 | |
| DER22_ARATH | DER2.2 | physical | 24833385 | |
| DERL1_ARATH | DER1 | physical | 24833385 | |
| CP21D_ARATH | AT3G66654 | physical | 24833385 | |
| SPCS1_ARATH | AT2G22425 | physical | 24833385 | |
| PAM74_ARATH | AT5G59650 | physical | 24833385 | |
| VA723_ARATH | VAMP723 | physical | 24833385 | |
| BETL2_ARATH | AT1G29060 | physical | 24833385 | |
| TBL18_ARATH | TBL18 | physical | 24833385 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
